KEGG   Caulobacter sp. K31: Caul_2523Help
Entry
Caul_2523         CDS       T00651                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cak  Caulobacter sp. K31
Pathway
cak00230  Purine metabolism
cak01100  Metabolic pathways
Module
cak_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Caul_2523
Enzymes [BR:cak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Caul_2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 RsgA_GTPase MobB AAA_18 Roc AAA_35 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ABZ71650
JGI: Caul2523
UniProt: B0SWM2
Position
2736999..2737643
Genome map
AA seq 214 aa AA seqDB search
MSNNPHGRTRGLLLMVVAPSGVGKTSLTRRLVADHNDLHLSISATTRAPRPGEHDGRDYH
FVSQDTFQAMLDDDAFLEWAEVYGNHYGSPRGPIMEALDRGESVLFDIDFQGAMKVHKQA
GEDSVLVYILPPSLAEMSRRLHARSQDSEEVIHRRLARAKDEVAAWEQFDYVILNDDFDR
AYSDLAHIYHAERQKRTRNPWIGNLVEDLLKEEI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataacccgcacggacgcacgcgcggcctgctgctgatggtggtggcgccctcg
ggcgtcggcaagacctcgctgacccgccgcctggtcgccgaccataacgacctgcatctg
tcgatcagcgccaccacccgcgccccgcgtccaggcgagcacgacggccgcgactaccat
ttcgtcagccaggacacgttccaggccatgctcgacgatgacgccttcctcgaatgggcc
gaggtctacggcaaccactatggcagcccgcgcgggccgatcatggaggcgctggatcgc
ggtgagagcgtgctgttcgatatcgacttccagggcgcgatgaaggtgcacaagcaggcg
ggcgaggacagcgtcctggtctacatcctgccgccgtccctggccgagatgagccgccgc
ctgcacgcccgcagccaggacagcgaagaggtcatccaccgccgcctggcccgcgccaag
gacgaggtcgccgcctgggagcagttcgactacgtgatcctcaacgatgacttcgaccgc
gcctattccgacctggcccacatctaccacgccgagcgccagaagcggacgcgcaacccg
tggatcggcaacctggtcgaggatctgctgaaggaagagatttag

DBGET integrated database retrieval system