KEGG   Caulobacter sp. K31: Caul_2612Help
Entry
Caul_2612         CDS       T00651                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cak  Caulobacter sp. K31
Brite
Enzymes [BR:cak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Caul_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2834898..2835446
Genome map
AA seq 182 aa AA seqDB search
MANEFWDGVTVPPAATVVVKRVEGFFGHPYDDNGALPGGTWTIGYGTIRDAAGKPVTPST
PAIAEAQATKLLMRDMQRAAKDVANRVNIDLLEHEAAALISWTYNLGDGALRTSTLLRKL
NAGDKAAAPSEMRRWINQAGKPLVGLLRRRWAEAAIFQGKDPVNACVRAWREIDDLDDWP
AF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgaattctgggatggcgtgacggtcccgccggcagccaccgtcgtggtcaag
cgggtcgagggcttcttcggccatccctatgacgacaacggcgccttgccgggcggaacc
tggacgatcggctacggcacgatccgtgacgcggccggcaagccggtgacgccttccacc
ccggccatcgccgaggcccaggccaccaagctgttgatgcgcgacatgcaacgcgcggcc
aaggacgtcgccaatcgcgtgaacatcgacctgctggaacacgaggccgccgctttgatc
tcgtggacctacaatctcggcgacggggcgctgcgcacctcgaccctgctgcggaaactc
aacgccggcgacaaggcggccgcgccgtcggagatgcgccgctggatcaaccaggcgggc
aagccgctggtgggcctgctgcgtcgccgctgggccgaggccgcgatcttccaaggcaag
gatccggtcaacgcctgcgtccgcgcctggcgggagatcgacgacctggacgactggccg
gcgttctag

DBGET integrated database retrieval system