KEGG   Caulobacter sp. K31: Caul_2748Help
Entry
Caul_2748         CDS       T00651                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase
Organism
cak  Caulobacter sp. K31
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:cak00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    Caul_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2985921..2986979
Genome map
AA seq 352 aa AA seqDB search
MSDVETTLRGPEAYKIAGRALGLMERHQVWPTALNFELWTHFVADPDGALARELTRLISL
GEPLTELLSEELAATYLPKAKLNEQIRDAGDLLSKELESVSKAIQDAQKSNAAYGKTLTG
AAKELDSDDVSKIKAVVSGLTEATRRVQKENKSLETRLAESTAEVDRLREHLEQVRRDAT
TDGLTNLANRKAFDDELDRACSEADEAGTTICLAVLDIDHFKGFNDTWGHQTGDQVIRYV
ASVIGRVAAPPRFAARYGGEEFAMIFPRESASIVAGTLEEIRVEVSSRMLKRRSTNEDLG
AITISSGFAERRPGETGHSVMERADAALYTSKRGGRNRVTAAESKPDSANAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtcgagaccacgctacgcggccctgaggcctataagatcgctggccgcgcg
ctgggcttgatggagcgtcatcaagtctggccaacggcgttgaatttcgaactttggact
cacttcgtcgccgaccccgacggcgccctggcccgtgaactgacccggctgatctcgctg
ggcgaaccacttaccgaactgctcagcgaagagctggcggcgacctacctgcccaaggcc
aagctgaacgagcagatccgcgacgccggcgatctgctcagcaaggaactggaatcggtc
tccaaagccatccaggacgcccagaagagcaacgccgcctacggcaagaccctgaccggc
gccgccaaggagctcgactccgacgacgtcagcaagatcaaggccgtcgtcagcggcctg
accgaggccacccggcgcgtccaaaaggaaaacaagtcgctggagacccgcctggcggaa
tccaccgccgaggtcgatcgtctgcgcgagcaccttgaacaggtccgccgcgacgccacc
accgacggcctgaccaatctggccaatcgcaaggccttcgacgacgagctcgaccgcgcc
tgctcggaagccgacgaagccggcaccaccatctgcctggccgtgctcgacatcgaccat
ttcaagggcttcaacgacacctggggccaccagaccggcgaccaggtcatccgttacgtc
gccagcgtcatcggccgcgtcgccgccccgccccgcttcgccgcccgctacggcggcgag
gagttcgcgatgatcttcccgcgggaatcggcgtcgatcgtcgccggcaccctggaagag
atccgcgtcgaggtgtcctcacgcatgctcaagcgccgctcgaccaacgaggacctgggc
gcgatcaccatctcatcgggcttcgccgaacgtcgtccgggcgagaccggtcactcggtc
atggagcgggccgacgcggcgctctatacctccaagcgcggcggccgcaaccgcgtcacc
gccgccgagagcaagccggactcggccaacgcggcctag

DBGET integrated database retrieval system