KEGG   Caulobacter sp. K31: Caul_2769Help
Entry
Caul_2769         CDS       T00651                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cak  Caulobacter sp. K31
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caul_2769
   01230 Biosynthesis of amino acids
    Caul_2769
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caul_2769
   00051 Fructose and mannose metabolism
    Caul_2769
   00562 Inositol phosphate metabolism
    Caul_2769
Enzymes [BR:cak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Caul_2769
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Caul_2769
  Exosomal proteins of bladder cancer cells
   Caul_2769
  Exosomal proteins of melanoma cells
   Caul_2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3007714..3008502)
Genome map
AA seq 262 aa AA seqDB search
MRRRPQTADMTLSLTTPRPLIAGNWKMFGLESSLDEARAVAAAIADKPPGARVAICPPAT
LLHRMAEAMAGESVLVGGQDCHSAPSGAHTGDISAAMLVDAGARLVILGHSERRAAYGES
DALVSAKVEAALAAGLEPIVCFGETCEQRDAGQAETVVTSMARESLPASLAGQAFAVAYE
PVWAIGTGRTPTTGDIAHIHAALRTVLVEKFGEQGRAVPILYGGSVKPDNAREILATPEV
GGALVGGASLKAADFLAIIAAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggaggccccaaaccgcagacatgaccctttccttgacgacgccccggccgctg
atcgccggaaactggaagatgttcggcctcgaatcttccctcgacgaggcccgcgcggtg
gccgccgccatcgccgacaagccgcccggcgcccgggtggcgatctgcccgccggccacc
ctgctgcaccgcatggccgaggccatggccggcgagagcgtgctggttggcggccaggac
tgccattccgccccctccggcgcccataccggcgacatctcggcggccatgctggtcgac
gccggcgcccgcctggtgattctcggccattccgagcgccgggcggcctatggcgagagc
gacgccctggtgtcggccaaggtcgaggcggccctggccgccggcctggagccgatcgtc
tgcttcggcgagacctgcgagcagcgcgacgccggccaggccgagacggtggtcacgagc
atggcgcgggaatccctgcccgccagcctggcgggccaggctttcgccgtggcctatgag
ccggtctgggcgattggtacaggccgcaccccgacgacgggcgacatcgcacatatccac
gccgccttgcggacggtgctggtcgagaagttcggcgagcagggcagggccgtgcccatc
ctctatggcggctcggtcaagcccgacaacgcccgcgagatcctggcgactcccgaagtc
ggtggagcgctggtcggcggggcttcactgaaggcggcggacttcctggcgatcatcgcg
gcggcgtag

DBGET integrated database retrieval system