KEGG   Caulobacter sp. K31: Caul_2769Help
Entry
Caul_2769         CDS       T00651                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cak  Caulobacter sp. K31
Pathway
cak00010  Glycolysis / Gluconeogenesis
cak00051  Fructose and mannose metabolism
cak00562  Inositol phosphate metabolism
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
cak01230  Biosynthesis of amino acids
Module
cak_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caul_2769
   00051 Fructose and mannose metabolism
    Caul_2769
   00562 Inositol phosphate metabolism
    Caul_2769
Enzymes [BR:cak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Caul_2769
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Caul_2769
  Exosomal proteins of bladder cancer cells
   Caul_2769
  Exosomal proteins of melanoma cells
   Caul_2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PRP4
Motif
Other DBs
NCBI-ProteinID: ABZ71896
JGI: Caul2769
UniProt: B0SYY5
Position
complement(3007714..3008502)
Genome map
AA seq 262 aa AA seqDB search
MRRRPQTADMTLSLTTPRPLIAGNWKMFGLESSLDEARAVAAAIADKPPGARVAICPPAT
LLHRMAEAMAGESVLVGGQDCHSAPSGAHTGDISAAMLVDAGARLVILGHSERRAAYGES
DALVSAKVEAALAAGLEPIVCFGETCEQRDAGQAETVVTSMARESLPASLAGQAFAVAYE
PVWAIGTGRTPTTGDIAHIHAALRTVLVEKFGEQGRAVPILYGGSVKPDNAREILATPEV
GGALVGGASLKAADFLAIIAAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggaggccccaaaccgcagacatgaccctttccttgacgacgccccggccgctg
atcgccggaaactggaagatgttcggcctcgaatcttccctcgacgaggcccgcgcggtg
gccgccgccatcgccgacaagccgcccggcgcccgggtggcgatctgcccgccggccacc
ctgctgcaccgcatggccgaggccatggccggcgagagcgtgctggttggcggccaggac
tgccattccgccccctccggcgcccataccggcgacatctcggcggccatgctggtcgac
gccggcgcccgcctggtgattctcggccattccgagcgccgggcggcctatggcgagagc
gacgccctggtgtcggccaaggtcgaggcggccctggccgccggcctggagccgatcgtc
tgcttcggcgagacctgcgagcagcgcgacgccggccaggccgagacggtggtcacgagc
atggcgcgggaatccctgcccgccagcctggcgggccaggctttcgccgtggcctatgag
ccggtctgggcgattggtacaggccgcaccccgacgacgggcgacatcgcacatatccac
gccgccttgcggacggtgctggtcgagaagttcggcgagcagggcagggccgtgcccatc
ctctatggcggctcggtcaagcccgacaacgcccgcgagatcctggcgactcccgaagtc
ggtggagcgctggtcggcggggcttcactgaaggcggcggacttcctggcgatcatcgcg
gcggcgtag

DBGET integrated database retrieval system