KEGG   Caulobacter sp. K31: Caul_2778Help
Entry
Caul_2778         CDS       T00651                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cak  Caulobacter sp. K31
Pathway
cak00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01130  Biosynthesis of antibiotics
cak01230  Biosynthesis of amino acids
Module
cak_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caul_2778
Enzymes [BR:cak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Caul_2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Lactamase_B_5
Motif
Other DBs
NCBI-ProteinID: ABZ71905
JGI: Caul2778
UniProt: B0SYZ4
Position
3015919..3016707
Genome map
AA seq 262 aa AA seqDB search
MTDILAKIAAYKREDVADRKRRRSIAQLEAAAKAANSPRGFKAALEADHAPGKLALIAEI
KKASPSKGLIRADFDPPALARAYAAGGASCLSVLTDGPSFQGADGYLIDVRAAVSLPCIR
KDFLVDPWQVAESRALGADAILVILAMIDDAVAADLMSEAARLGMDALVEVHDEAEMERA
GKLGSTLVGINNRDLKSFVVDLAVTERLAVQAPSDALLVTESGLFVAADVARMEAAGAKA
MLVGESLMRQADVAAATRALLG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcgccaagatcgccgcctacaagcgcgaggacgtggccgatcggaaa
cgtcgccggtccattgctcagctcgaggccgccgccaaggccgccaacagcccgcgcggc
ttcaaggccgcgctcgaggccgaccacgcgccaggcaagctggctctgatcgccgaaatc
aagaaggcctcgccgtccaagggcctgatccgcgccgacttcgacccgccagctctggcc
cgcgcctatgccgcgggcggcgcatcgtgcctgtcggtgctgaccgacggccccagcttc
cagggggctgacggctatctgatcgacgtccgcgccgccgtcagcctgccctgcatccgc
aaggacttcctcgtcgacccctggcaggtggccgagagccgcgccctgggcgccgacgcc
atcctggtgatcctggcgatgatcgacgacgccgtcgccgccgacctgatgagcgaggcc
gcccgcctgggcatggacgccctggtcgaggtgcacgacgaggccgagatggagcgagcc
ggcaagctgggctcgaccctggtcgggatcaacaaccgcgacctgaaaagcttcgtcgtc
gacctggccgtcaccgaacgcctggccgtccaggcgcccagcgacgccctgctggttacc
gaaagcggcctgttcgtcgccgccgacgtggcgcgcatggaagcggctggcgccaaggcc
atgctggtcggcgagagcctgatgcgccaggcggatgtggccgccgcgacgcgagccttg
ctgggctag

DBGET integrated database retrieval system