KEGG   Caulobacter sp. K31: Caul_3027Help
Entry
Caul_3027         CDS       T00651                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cak  Caulobacter sp. K31
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Caul_3027
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Caul_3027
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Caul_3027
Enzymes [BR:cak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Caul_3027
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caul_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3292851..3294356)
Genome map
AA seq 501 aa AA seqDB search
MTRAPLFLAAALVALTATSALAAPKPAPRPAAPVINAAPNDAYYKAGEAALAKALTVNPR
TGKAKNVILFLGDGMGISTMVASRIYEGQQRGVDGESNSLSFEKLPWTALSKTYSHDTQV
TDSAAGITAITTGVKTRNKIIGLTGAAKPEVCATEAGSRVQTIAELAKAHGLSAGAVTTT
RITHATPAGTYAHTAYRDWEGDSDMPTAALAGGCTDIARQLVEAPVGQRLDVAFGGGRSR
FLPEAKDGKRADGRDLTAEWLKAPNAAYVTTDTQLASLDPAKTGPVLGLFANEHLPYEVE
RPVLGQGVPTLAVMATKAVDLLSQNPKGYFLLVEGGKIDMGSHLNNAKRTLTETVEFSKA
VQAVLDKVDLNDTLVIVTADHSHGLVISGYANRNAPILGLAGNEGDPIVAGDGKPYTVLS
FATGPGGPEGGGSRADPSKEDTDDIDYHQAAVANLPSSAHSGEDVGVFADGPGSYLVHGV
VEESYLYQIMRHAYGFDEAAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgcccccctgtttctcgccgccgccctcgtcgccctgaccgccacctcggcc
ctggccgcgcccaagcctgctcccaggccggccgctcccgtgatcaacgccgcgccgaac
gacgcctactacaaggccggcgaggcggctctggccaaggccctgacggtcaatccccga
accggcaaggccaagaacgtcatcctgttcctcggcgacggcatgggcatctcgacgatg
gtcgccagccggatctacgagggccagcagcgcggcgtcgatggcgagagcaattcgctg
tcgttcgagaaactgccgtggacggcgctgtccaagacctacagccacgacacccaggtc
accgacagcgccgccggcatcaccgccatcaccaccggggtgaaaacccgcaacaagatc
atcggcctgaccggcgcggccaagccggaggtctgcgccaccgaggccggctcccgcgtc
cagaccatcgccgaactggccaaggcccatggcctgtcggcgggcgcggtgacgaccacc
cgcatcacccacgccaccccagccgggacctacgcccacacggcctatcgcgactgggag
ggcgatagcgacatgccgaccgccgccctggccggcggctgcaccgacatcgcgcgtcaa
ctggtcgaggccccggtcggccagcgcctggacgtggcgttcggcggcgggcgttcgcgc
ttcctgcccgaggccaaggacggcaagcgcgccgacggtcgcgacctgaccgccgaatgg
ctcaaggctccgaacgccgcctatgtgaccaccgacacccagttggcgagcctggacccg
gccaagaccggccctgtgctgggcctgttcgccaacgagcacctgccctacgaggtcgag
cggccggtgctggggcagggcgtgccgaccctggcggtcatggccaccaaggccgtcgac
ctgctgtcgcaaaaccccaagggctatttcctgctcgtcgagggcggcaagatcgacatg
ggcagccacctcaacaacgccaagcggaccctgaccgagacggtcgagttctccaaggcg
gtgcaggccgtgctcgacaaggtcgacctgaacgacaccctggtcatcgtcaccgccgac
cacagccacggcctggtgatctcgggctacgccaaccgcaatgccccgatcctgggcctg
gcgggcaacgagggtgacccgatcgtggctggcgacggcaagccctataccgtgctgagc
ttcgccaccggccccggcggcccggaaggcggcggctcgcgcgccgacccctcgaaggaa
gacaccgacgacatcgactaccaccaggccgcggtggccaacctgcccagcagcgcccac
tcgggcgaggatgtcggcgtgttcgcagacggcccgggatcctacctggtccacggcgtg
gtcgaggagagctacctctaccagatcatgcgccacgcctacggcttcgacgaggcggcg
aagtag

DBGET integrated database retrieval system