KEGG   Caulobacter sp. K31: Caul_3057Help
Entry
Caul_3057         CDS       T00651                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cak  Caulobacter sp. K31
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caul_3057
Enzymes [BR:cak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Caul_3057
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caul_3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3319232..3320236
Genome map
AA seq 334 aa AA seqDB search
MTTPPLAPYPATRLRRLRQADWIRRSVRETTLSPSDLIWSMVVHEGEGVIPVASMPGVER
LSVKEAAKAAVRARDLGIPAIAIFPHIDGSRKDATGSIAADPNGVIPRAVKAMKDAAPEV
GIMCDVALDPFTDHGHDGVVEGGKILNDPTIERLIEQGLMQAEAGADILAPSDMMDGRIG
ALRAALEGASFQDTLIMSYAAKYASAFYGPYRDAIGSAKLSAGQGDKKTYQMDPANTEEA
IREVMLDIAEGADMIMVKPGMPYLDILRRLVDEFRMPTYAFQVSGEYAMIKAAGMNGWID
EERAILESLTAFKRAGAAGIISYFAPWAAEKLGA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccccgctcgccccctaccccgccacccgcctgcgtcgcctgcgccaggcc
gactggatccgccgatcggtccgcgagaccacgctttcgccgtccgacctgatctggtcg
atggtggtgcacgagggcgagggcgtgattccggtggcctcgatgcccggcgtcgaacgc
ttgtcggtcaaggaagccgccaaggccgccgtgcgggcccgcgacctgggcattccggcc
atcgccatcttcccgcacatcgacgggtcgcggaaggacgccaccggctcgatcgccgcc
gacccgaacggcgtcatcccccgcgccgtcaaggccatgaaggacgccgcccccgaggtc
ggcatcatgtgcgacgtggcgctggacccgttcaccgatcacggccacgacggcgtggtc
gagggcggcaagatcctcaacgacccgaccatcgagcgcctgatcgagcaaggcctgatg
caagccgaggccggcgccgacatcctggccccgtccgacatgatggacggccggatcggc
gccctgcgcgcggccctggagggcgccagcttccaggacaccctgatcatgtcctacgcc
gccaagtacgcctcggccttctacggcccgtaccgcgacgccatcggctcggcgaaactg
tcggccggccagggcgacaagaagacctaccagatggacccggccaacaccgaggaggcc
atccgcgaggtgatgctcgacatcgccgagggcgccgacatgatcatggtcaagccgggc
atgccgtatctcgacatcctgcgccgcctggtcgacgagttccgcatgcccacctacgcc
ttccaggtgtcgggcgagtacgcgatgatcaaggccgccgggatgaacggctggatcgac
gaggaacgcgcgatcctcgaaagcctgaccgccttcaagcgggccggcgcggccgggatc
atcagctacttcgcgccgtgggcggcggagaagctgggggcgtga

DBGET integrated database retrieval system