KEGG   Caulobacter sp. K31: Caul_3076Help
Entry
Caul_3076         CDS       T00651                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
cak  Caulobacter sp. K31
Pathway
cak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cak00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Caul_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABZ72203
JGI: Caul3076
UniProt: B0T1L4
Position
3336595..3337092
Genome map
AA seq 165 aa AA seqDB search
MRQYHLAIVAIGCVLLTGCSKPKETTSDSVSATPAIAAPTDVEKQALLAALPAPYNTGDL
LNGQSKFALCRSCHTITQGGPNMTGPNLYGVFGRKAGGKPDYQYSPVVAAAGFDWDAEHL
DKWLDNPRGFMPGTKMTFAGLHDPKDRIDLIAYLKVETGYKPPKG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagtatcacctcgcgatcgtggcgatcggttgcgttctcttgaccggttgctcc
aagcccaaggagacgacctccgacagcgtttcggcgactcccgcgatagcggcgcccacc
gacgtcgagaagcaggccctactggccgccctccccgcgccttacaacaccggcgacctg
ctgaacggccagagcaagttcgccctttgccgttcgtgccacaccatcacccaggggggg
ccgaacatgaccggtcccaacctctatggcgtgttcggccgcaaggcgggcggcaagcct
gactatcagtactcgccagtggtcgccgccgcgggcttcgactgggacgccgaacatttg
gacaagtggctcgacaacccacgcggcttcatgcccggcaccaagatgaccttcgcgggc
ctgcacgaccccaaggatcgcatcgacctgatcgcctatttgaaggtcgagaccggatac
aagcccccgaagggctga

DBGET integrated database retrieval system