KEGG   Caulobacter sp. K31: Caul_3180Help
Entry
Caul_3180         CDS       T00651                                 

Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
cak  Caulobacter sp. K31
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cak00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3443909..3444910
Genome map
AA seq 333 aa AA seqDB search
MHLARFPRARFAHLPTPLEPLPRLGAELGIDLWVKRDDCTGLAGGGNKTRKLEFLLGEAL
AQGADTLVTQGAVQSNHVRQTIAAGVRFGLKSEIILEERTGSKASDYTGNGNVLLDRLMG
ASIRFVPGGTDMVEELEISAARVRQRGGKPYVIPGGGSNTVGALGYVDCARELVVQADAM
DLKIDRLVTATGSAGTHAGLVAGFAALSVDIPILGFGVRAPKARQEENVFNLAVATAETI
GAGGRVTRDRVIADCDYVGAGYGLVDQGVIDALTLAARTEGLLLDPVYSGKAMKGLIDQA
RKGAFKGERVVFLHTGGAQGLFGYQSELEAALV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcatctggcccgtttcccccgcgcccgtttcgcccacctgcccacgcccctggagccc
ctgccccgcctgggcgcggagctcgggatcgacctgtgggtcaagcgcgacgactgcacc
ggcctggccggcggcggcaacaaaacccgcaagctggagttcctgctgggcgaggcgctc
gcgcaaggcgccgacaccctggtgacgcagggcgcggtgcagtccaaccacgtgcgccag
accatcgccgccggggtccggttcggcctgaagagcgagatcatcctggaggagcgcaca
ggctccaaggccagcgactataccggcaacggcaatgtgctgctcgaccggctgatgggc
gcctcgatccgctttgtgcccggtgggaccgacatggtcgaggagctggagatttcagcg
gcgagggtgcgccagcgcggcggcaagccctatgtcatccccggcggcggctccaacacg
gtcggggcgctgggctatgtcgattgcgcccgcgaactggtggtgcaggccgacgccatg
gatctgaagatcgaccgtctggtcaccgccaccggcagcgccggcacccacgccggcctg
gtcgcgggcttcgcggcgctcagcgtcgacatcccgatcctgggctttggcgtgcgcgcc
cctaaggccaggcaggaggaaaacgtcttcaacctggcggtcgccacggccgagaccatc
ggcgccggcggacgggtgacgcgggacagggtgatcgccgactgcgactatgtcggcgcg
ggctacggcctggtcgaccagggggtgatcgacgccctgaccctggcggctcgcaccgag
ggcctgctgctggatccggtctactccggcaaggcgatgaagggcctcatcgaccaggcc
cgcaagggcgcgttcaagggcgagcgggtggtgttcctgcacaccggcggggcgcagggg
ttgtttgggtatcaaagcgaactggaggcggcccttgtctaa

DBGET integrated database retrieval system