KEGG   Caulobacter sp. K31: Caul_3303Help
Entry
Caul_3303         CDS       T00651                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cak  Caulobacter sp. K31
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cak00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Caul_3303
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Caul_3303
Enzymes [BR:cak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Caul_3303
Two-component system [BR:cak02022]
 CheA family
  CheA-CheYBV
   Caul_3303
Bacterial motility proteins [BR:cak02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Caul_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3577654..3578754)
Genome map
AA seq 366 aa AA seqDB search
MTRLLIVDDSALMRRVLGDVFQNEPGFEVAFARDGVEALAQVHAFRPDVITLDVQMPRMD
GLSCLDRIMVERPCPVVMVSSLTAEGADATLEALELGAVDFVAKPDGAVSLAIDDFGPIL
VEKVVTAAASRLRRSHRLAERLRARHGAIATSPPAPPQPRGKPAAAWKPRPAGMPPGLVI
IGTSTGGPPALDVVLSEMPADFPWPILVAQHMPAAFTASLAHRLDGLCALRVIEVARPTP
LIPGCVYVARGDADMTVSRRSAGPVALSAPSSAEHRWHPSVDRLVDSAALAVPPERLVGV
LMTGMGNDGARSMAALRAAGGRTIAESEDTAVVWGMPGELVKAGGADVVAPLDSIAGKIR
EMVWAG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcctgctgatcgttgacgattccgccctcatgcgccgcgtgctgggcgacgtc
tttcagaacgagcccggcttcgaggtagccttcgcgcgcgatggcgtcgaggcgctggcg
caggtgcacgccttcaggcccgacgtgatcaccctcgacgtccagatgccgcgcatggac
ggtctcagctgcctggaccgcatcatggtcgagcgaccctgcccagtggtcatggtgtcg
tcgctgacggcggagggcgcggacgccaccctggaggctctggaactgggcgcggtggat
ttcgtcgccaagccggatggcgcggtgtccctggcgatcgacgacttcggaccgatcctg
gtcgagaaggtggtgacggcggcggcgtcgcgtctgcgccggtcgcatcgtctggcggag
cgactgcgtgcgcgtcatggcgcgatcgcaacgtcgccgccagcgccgcctcagccgcgt
ggcaagcccgcggcggcctggaagcctcggcccgcgggcatgccgccgggcctggtgatc
atcggcacgtcgacgggaggcccacccgcgctcgacgtggtgctgtccgagatgcccgcc
gacttcccctggccgatcctcgtggcccagcatatgcccgccgcgttcacggcgtccctg
gcccatcggctggacggcctgtgcgccctgcgggtgatcgaggtggcgcggcccacgccg
ctgattccaggctgcgtctatgtcgcgcggggcgacgccgacatgaccgtgagccgccgg
agcgctggacccgtggcgctgtcggccccctccagcgccgagcatcgctggcatccaagc
gtcgatcgcctggtcgacagcgccgccttagccgtgcctcccgagcggttggttggggtc
ttgatgaccggcatgggcaatgacggcgctcgctcgatggccgcgctgcgggcggcgggc
gggcgcacgatcgccgagtcggaagacaccgccgtcgtctggggcatgccgggcgagctg
gtgaaggcaggtggggccgacgttgtggcgccgctggactccatcgcgggcaagatccgc
gaaatggtgtgggcggggtga

DBGET integrated database retrieval system