KEGG   Caulobacter sp. K31: Caul_3618Help
Entry
Caul_3618         CDS       T00651                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cak  Caulobacter sp. K31
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cak00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cak00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3905317..3906471
Genome map
AA seq 384 aa AA seqDB search
MKTSGHKLTRVLLAAIAVALPAGAFAADYARAPFGKTPDGTEVEAITLTNGHGVSATIIT
YGATLQSLVAPDRTGAKADIALGFADAGAYVKNASYFGASVGRFANRIGKGKFALDGKTY
QLALNNNGVAALHGGVKGFDKQVWKVVDVKRGPVASVTFSHISPDGDEGYPGTLTATATY
ALGENNDLTVTYGATTDKPTIVNLTNHALFNLAGEGSADGAMGNVLTLASDGYTPVDAEL
IPTGAITPVAGTPFDFRKPTVVGERIRDARDPQIVIGRGYDHNMVLTGKAGGAPRLAARL
ADPKSGRVMEILSDQPGIQFYTGNFIDGTMVGKSGKIYRQGDGIALEPQHFPDAPNKPAF
APVRLDPGQTYSNTMVFRLTTDKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcaggccacaaactgacccgcgtccttctggccgccatcgccgtcgccctt
ccggccggagccttcgcggcggactatgcccgcgccccgttcggcaagacgcccgacggg
accgaggtcgaggctataaccctgaccaatggccacggcgtcagcgccaccatcatcacc
tacggcgccaccctgcagtcgctggtcgcccccgaccggaccggcgccaaggccgacatc
gccctgggcttcgccgacgccggcgcctacgtcaagaacgccagctatttcggggcctcg
gtgggccggttcgccaaccgcatcggcaagggcaagttcgcgctggacggcaagacctac
cagctggcgctgaacaacaacggcgtcgccgccctgcacggcggggtcaagggcttcgac
aagcaggtctggaaggtggtcgacgtcaagcgcggccccgtcgcctccgtcaccttcagc
catatcagcccggacggcgacgagggctatccaggaaccctgaccgcgacggccacctac
gccctgggtgagaacaacgacctgacggtcacctacggcgccacgaccgacaagccgacc
atcgtcaacctgaccaaccacgccctgttcaacctcgcgggcgagggctcggccgatggc
gcgatgggcaatgtcctgaccctggcgtccgacggctacacgccggtcgacgccgaactg
atcccgaccggggcgatcacgccggtggccggcacgccgttcgacttccgcaagcccacg
gtggtgggcgaacgcatccgcgacgcccgcgacccgcagatcgtcatcggccgcggctac
gaccacaacatggtgctgaccggcaaggctggcggcgcgccgcgcctggccgcccgtctg
gccgatcccaagagcggccgggtgatggagatcctcagcgaccagccgggcatccagttc
tacaccggcaacttcatcgacggcacgatggtgggcaagagcggcaagatctatcgccag
ggcgacggcatcgcgcttgagccgcagcacttccccgacgcccccaacaagccggccttc
gcgccggtgcggctggacccgggccagacctacagcaacacgatggtgttccgcctgacg
acggacaagaagtaa

DBGET integrated database retrieval system