KEGG   Caulobacter sp. K31: Caul_3618Help
Entry
Caul_3618         CDS       T00651                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cak  Caulobacter sp. K31
Pathway
cak00010  Glycolysis / Gluconeogenesis
cak00052  Galactose metabolism
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caul_3618
   00052 Galactose metabolism
    Caul_3618
Enzymes [BR:cak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Caul_3618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABZ72745
JGI: Caul3618
UniProt: B0T7Y2
Position
3905317..3906471
Genome map
AA seq 384 aa AA seqDB search
MKTSGHKLTRVLLAAIAVALPAGAFAADYARAPFGKTPDGTEVEAITLTNGHGVSATIIT
YGATLQSLVAPDRTGAKADIALGFADAGAYVKNASYFGASVGRFANRIGKGKFALDGKTY
QLALNNNGVAALHGGVKGFDKQVWKVVDVKRGPVASVTFSHISPDGDEGYPGTLTATATY
ALGENNDLTVTYGATTDKPTIVNLTNHALFNLAGEGSADGAMGNVLTLASDGYTPVDAEL
IPTGAITPVAGTPFDFRKPTVVGERIRDARDPQIVIGRGYDHNMVLTGKAGGAPRLAARL
ADPKSGRVMEILSDQPGIQFYTGNFIDGTMVGKSGKIYRQGDGIALEPQHFPDAPNKPAF
APVRLDPGQTYSNTMVFRLTTDKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcaggccacaaactgacccgcgtccttctggccgccatcgccgtcgccctt
ccggccggagccttcgcggcggactatgcccgcgccccgttcggcaagacgcccgacggg
accgaggtcgaggctataaccctgaccaatggccacggcgtcagcgccaccatcatcacc
tacggcgccaccctgcagtcgctggtcgcccccgaccggaccggcgccaaggccgacatc
gccctgggcttcgccgacgccggcgcctacgtcaagaacgccagctatttcggggcctcg
gtgggccggttcgccaaccgcatcggcaagggcaagttcgcgctggacggcaagacctac
cagctggcgctgaacaacaacggcgtcgccgccctgcacggcggggtcaagggcttcgac
aagcaggtctggaaggtggtcgacgtcaagcgcggccccgtcgcctccgtcaccttcagc
catatcagcccggacggcgacgagggctatccaggaaccctgaccgcgacggccacctac
gccctgggtgagaacaacgacctgacggtcacctacggcgccacgaccgacaagccgacc
atcgtcaacctgaccaaccacgccctgttcaacctcgcgggcgagggctcggccgatggc
gcgatgggcaatgtcctgaccctggcgtccgacggctacacgccggtcgacgccgaactg
atcccgaccggggcgatcacgccggtggccggcacgccgttcgacttccgcaagcccacg
gtggtgggcgaacgcatccgcgacgcccgcgacccgcagatcgtcatcggccgcggctac
gaccacaacatggtgctgaccggcaaggctggcggcgcgccgcgcctggccgcccgtctg
gccgatcccaagagcggccgggtgatggagatcctcagcgaccagccgggcatccagttc
tacaccggcaacttcatcgacggcacgatggtgggcaagagcggcaagatctatcgccag
ggcgacggcatcgcgcttgagccgcagcacttccccgacgcccccaacaagccggccttc
gcgccggtgcggctggacccgggccagacctacagcaacacgatggtgttccgcctgacg
acggacaagaagtaa

DBGET integrated database retrieval system