KEGG   Caulobacter sp. K31: Caul_4064Help
Entry
Caul_4064         CDS       T00651                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cak  Caulobacter sp. K31
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cak00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4400893..4401486
Genome map
AA seq 197 aa AA seqDB search
MSTPPPLAPKPPVPEDVQEAIRTLIRWTGEDPSREGLVDTPSRVARAWKEYCEGYGEDPA
QHLSRVFEEVGGYDDIVLLKDVPFQSHCEHHMAPIIGKAHIAYLPRDRVVGISKLARVLH
GFARRLQIQERLTAEIADCLWDNLQPLGVAVVIEASHACMSGRGVRTPGVTMKTSRMMGV
FRDDERSRREVLSLMGF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccccgcccctcgcccccaagcccccggttcccgaggacgtccaggaggcc
atccgcaccctgatccgctggaccggcgaggatccgtcgcgcgaggggctggtcgacacc
ccgtcgcgggtggcgcgggcctggaaggaatattgcgagggctatggcgaggaccccgcc
cagcacctgtcgcgggtgttcgaggaggtcggcggctatgacgacatcgtgctgctcaag
gacgtcccgttccaatcgcattgcgagcaccacatggcgccgatcatcggcaaggcgcac
atcgcctacctgccgcgcgaccgggtggtggggatctccaagctggcgcgggtgctgcac
ggcttcgcccggcggctgcagatccaggagcgcctgaccgccgagatcgccgactgcctg
tgggacaacctccagcccctgggcgtggccgtggtcatcgaggccagccacgcctgcatg
agcggccgcggcgtgcgcacccctggcgtgacgatgaagaccagccggatgatgggcgtg
ttccgcgacgacgaacgctcccggcgcgaggtgctgtcgctgatgggcttctga

DBGET integrated database retrieval system