KEGG   Caulobacter sp. K31: Caul_4083Help
Entry
Caul_4083         CDS       T00651                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cak  Caulobacter sp. K31
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cak00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cak00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cak00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4427107..4429605
Genome map
AA seq 832 aa AA seqDB search
MVEFSRRQALAATAAGAALAATSPTRAAPSKGKPAPMVPAVPAIDLAPRERLSLDFDWRF
KLGHAQDPARDFGFGANQGTFAKAGKVVAAAELDFDASAWAPVTLPHDWAVELPFVDNPA
YVPSGKPDDGDPRAAHGYKPLGREFPETSIGWYRKTFALPATDAGKRLSIEFDGAFRDAL
VIVNGYILEREDSGYSPFRVDITDIANVGGDNSLVVRIDASLGEGWFYEGAGLYRHVWLV
KTATVHVPQWGVFVRAKLDGTLTIDTDLVNEGDARIDYELAHAVFDGQGKPVLAPAPATG
LLPAWERQSLSLTAQLPNPVPWSLETPHLYTLATEVRVGGAVVDRFVTRFGVRSIAFDPD
KGFLLNGQSVKLKGTCNHQDHAGVGAAIPDALQVWRLEQLKSMGCNAYRTAHNPPTPELL
DACDRLGMVVIDETRRMSSDPTSLEELERLVRRDRNHPSVILWSIGNEEPQQGTARGAKV
ATTMKRLVNRLDPTRLVTAAMDQGFGEGISPVLDVQGFNYRHEKMDDFHARFPHVPIIGT
ESASTVATRGEYARDDAKSYVPAYDTEHPWWATTAETWWSHAADRPWVAGGFIWTGFDYR
GEPTPFNRWPSISSHFGALDTCGFPKDNYYYYRAWWRPEPLLHLLPHWNWEGREGQPIAV
WAHSNCDKVELFLNGKSQGVRLVTPNNHVEWSVPYAPGVIEAHGYKGGKLILRERRETAG
PAAALRLTVDRSRLAADGQDVAILKVEVLDAKGRPAPRADDLVSFTLSGPGQVIGVGNGN
PTSHEADVASQRKAFNGLVQAIVRTRRGQAGELRVTASAAGLKPSTMSVTVG
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaattcagccgccgccaggccttggccgccaccgccgcgggcgccgccttggcc
gccacgtctcccacgcgcgccgccccctcgaagggcaagccggcccctatggtccccgcc
gtccccgccatcgacctggccccgcgcgagcgcctgtcgctggacttcgactggcgcttc
aagctgggtcacgcccaggatccagcccgcgacttcggcttcggggccaatcagggcacg
ttcgccaaggccggcaaggtcgtcgccgcggccgaactcgacttcgacgccagcgcctgg
gcgcccgtcaccctgccccacgactgggccgtcgagctgcccttcgtcgacaaccccgcc
tacgtcccgtccggcaagcccgacgacggggacccgcgcgccgcccacggctacaagccc
ctgggccgcgagttccccgagaccagcatcggctggtaccgcaagaccttcgcccttccc
gccaccgacgccggcaagcggttgtcgatcgagttcgacggcgccttccgcgacgccttg
gtgatcgtcaacggctacatcctcgagcgcgaggacagcggctattcgccgtttcgcgtc
gacatcaccgacatcgccaatgtcggcggcgacaacagcctggtggtgcggatcgacgcc
agcctcggcgagggctggttctacgagggcgcgggcctctatcgccacgtctggctggtc
aagaccgccacggttcacgtgccccagtggggcgtgttcgtgcgcgccaagctcgacggg
accctgaccatcgacaccgacctggtcaacgaaggcgacgcccgcattgactatgagctg
gcccacgccgtgttcgacggtcagggcaaaccggtgctggcccctgccccggccacgggc
ctgctgccggcctgggagcggcagtcgctgtccctgaccgcccagcttccgaacccggtc
ccgtggtcgctggagaccccgcatctctacaccctggccaccgaggtcagggtcggcggc
gccgtggtcgaccgcttcgtcacccggttcggcgtgcggtcgatcgccttcgatcccgac
aagggcttcctgctgaacggtcagtccgtgaagctgaagggaacctgcaatcaccaggac
cacgccggggtcggcgcggccattcccgacgccctgcaggtctggcggctggagcagctc
aagtcgatgggctgcaacgcctatcgcaccgcgcacaacccgccgacgcccgagttgctc
gacgcctgtgaccgcctgggcatggtggtgatcgacgagacccgccgaatgtccagcgat
ccaacctcgctggaggagttggagcgtctggtccgccgcgaccgcaaccacccgtcggtg
atcctctggtcgatcggcaacgaggagccgcagcagggcacggcccgcggcgccaaggtg
gcgaccacgatgaagcggctggtcaatcgcctggacccaacccgcctggtcaccgccgcc
atggatcagggctttggcgagggcatcagcccggtcctcgacgtccagggcttcaactat
cgccacgagaagatggacgacttccacgcgcgcttcccgcacgtgccgatcatcggcacc
gagagcgccagcaccgtggccacccgcggggaatacgcccgcgacgacgccaagagctac
gtcccggcctacgacaccgagcacccctggtgggcgaccaccgccgagacgtggtggagc
cacgcggccgaccggccgtgggtggccggcggcttcatctggaccggcttcgactatcgc
ggcgagcccaccccgttcaaccgctggcccagcatcagctcgcacttcggcgcgctcgac
acctgcggcttccccaaggacaactattactactaccgcgcctggtggcggcccgagccg
ctgttgcacctgttgccgcactggaactgggagggccgcgagggccaacccatcgcggtc
tgggcgcacagcaactgcgacaaggtcgagctgttcctgaacggcaagagccagggcgtt
cgccttgtcacccccaacaaccacgtcgaatggtccgtgccctatgcgcccggcgtgatc
gaggctcacggctacaagggcggcaagctcatcctgcgcgagcgccgcgagaccgccggt
cccgccgccgccctgcgcctcaccgtcgaccgctcgcgcctggccgccgacggccaggat
gtggcgatcctcaaggtcgaggtgctggacgccaagggccggcccgcgccccgcgccgac
gacctggtctcgttcacgctcagcggtccgggccaggtgatcggagtgggcaacggcaat
cccaccagccacgaggcggacgtcgccagccagcgcaaggcgttcaacggcctggtccag
gcgatcgtccgcacacggcgtgggcaggcgggggagctgcgggtgacggcgtcggcggcg
gggctgaagccaagcacgatgagcgtgacggtgggatga

DBGET integrated database retrieval system