KEGG   Caulobacter sp. K31: Caul_4214Help
Entry
Caul_4214         CDS       T00651                                 

Definition
(GenBank) hypothetical protein
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
cak  Caulobacter sp. K31
Pathway
cak00240  Pyrimidine metabolism
cak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Caul_4214
Enzymes [BR:cak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Caul_4214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABZ73338
JGI: Caul4214
UniProt: B0SYH1
Position
complement(4582179..4582550)
Genome map
AA seq 123 aa AA seqDB search
MDQQTLTFGRISAAAMVTTGLMALFLAARNDLVWDGPSSGTSPPGAADLMETLTRVDLEA
ETMRRVVEAEGGCLAWGGAVGLSPADDILIRVERVLDIERIVSTDSIAHPTNVIWLAPIF
VDP
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ttggatcagcaaacgcttacgttcggccgcatcagcgccgcagccatggttacgaccggt
ttgatggcgctctttctggcggcgcgaaatgatcttgtctgggatgggccgtcatcgggg
acgtcgccgccgggcgcggccgacctcatggagaccctgacccgcgtcgaccttgaggcc
gagaccatgcggcgtgtcgtggaggcggaaggcggctgcctggcctggggcggggcggtg
ggcctgagcccggcggacgatatcctcatccgggtcgagcgcgtgctcgatatcgagcgg
attgtttcgacggactccatcgcccatccgacaaacgtcatctggctggcgccgatcttc
gtcgacccttag

DBGET integrated database retrieval system