KEGG   Caulobacter sp. K31: Caul_4498Help
Entry
Caul_4498         CDS       T00651                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cak  Caulobacter sp. K31
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caul_4498
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caul_4498
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Caul_4498
Enzymes [BR:cak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Caul_4498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4870980..4872377)
Genome map
AA seq 465 aa AA seqDB search
MRYVSTRGEAPSIGFLDAVLAGLAPDGGLYVPERWPTFTPDEIAAFAGQPYAQVAATVIG
KFVGDDLPADDLREMCEEAYASFAHAAVTPLKQLAPGRYLLELFHGPTLAFKDVAMQLLG
RLYDYVLSRQSRTMTIICATSGDTGGAAVEAFRGRSHARIVALFPEGRISEVQRRFMTTA
TDKNVACVSIQGSFDDCQAIVKQAFSDDQFRHAVDLSGVNSINWARIAAQTVYFFTAAVA
LGAPARKVAFVVPTGNFGDAYAAYVASRMGLPIARIVAATNSNDILARAFEEGRYTRGAV
AATQSPAMDIQVASNFERLYFEAVGRDGVETGRAFRAFAGTGMLDIPPSAHAKMRELFQG
ASVSEADTAKTILSTLNETGELIDPHTAVGVAAATKLRLADPTTPVVVLSTAHPAKFPEA
VLAAAGLTPATPRATPDLSKKPEKFDRLPADAETVKAFVRVFAAG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtctccacacggggtgaagccccatcgatcggtttccttgatgcggtcctg
gccggcctggcccccgacggcggcctctatgtgcccgagcgctggccgaccttcacaccc
gatgagatcgcggccttcgccggccagccctacgcccaggtggccgccacggtgatcggc
aagttcgtcggcgacgacctgcccgccgacgatctgcgcgagatgtgcgaagaggcctat
gccagcttcgcccacgccgccgtcacgccgctcaagcaactggcccccggccgctacctg
ctggagctgttccacggcccgaccctggccttcaaggacgtggcgatgcagctgctgggg
cggctgtacgactacgtgctgtcgcgccagtcgcggaccatgaccatcatctgcgccacc
tcgggggacaccggcggcgcggccgtcgaggccttccgcggccgctcgcacgcccgcatc
gtggccctgttccccgaaggccggatcagcgaggtccagcgtcggttcatgaccacggcc
accgacaagaacgtcgcctgcgtctcgatccagggctcgttcgacgactgccaggccatc
gtcaagcaggccttctcggacgaccagttccgccacgccgtcgacctgtcgggcgtcaac
tcgatcaactgggcgcgcatcgccgcccagaccgtctatttcttcaccgccgccgtcgcc
ctgggcgccccggcccgcaaggtggccttcgtggtgccgaccggcaatttcggcgacgcc
tacgccgcctatgtcgccagccggatgggcctgccgatcgccaggatcgtggccgccacc
aattccaacgacatcctggcgcgggccttcgaggagggccgctacacgcgcggcgccgtg
gccgccacccagagcccggccatggacatccaggtggccagcaatttcgagcggctctat
ttcgaggccgtcggccgcgacggggtcgagaccggccgggccttccgggccttcgccggc
acggggatgctcgacatcccacccagcgcccacgccaagatgcgcgagctgttccagggc
gcgtcggtcagcgaggccgacaccgccaagaccatcctgtcgaccctgaacgaaaccggc
gagctgatcgacccgcacaccgccgtcggcgtggccgccgcgaccaagctgcgcctggcc
gacccgacgaccccggtcgtggtgctgtccaccgcccacccggccaagttccccgaagcc
gtgctggccgccgccggcctgaccccggccacgccgcgcgccaccccggacctgtcgaag
aagccggagaagttcgaccgcctgccggccgacgccgagacggtgaaggccttcgtgcgg
gtgttcgcggcggggtga

DBGET integrated database retrieval system