KEGG   Caulobacter sp. K31: Caul_4562Help
Entry
Caul_4562         CDS       T00651                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cak  Caulobacter sp. K31
Pathway
cak00300  Lysine biosynthesis
cak01100  Metabolic pathways
cak01120  Microbial metabolism in diverse environments
cak01230  Biosynthesis of amino acids
Module
cak_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Caul_4562
Enzymes [BR:cak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Caul_4562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABZ73682
JGI: Caul4562
UniProt: B0T134
Position
4939897..4941063
Genome map
AA seq 388 aa AA seqDB search
MMTSPAPEPVSIDSVALAQALIRRPSVTPADEGAMDVLQRQLEALGFNCRRMKFGEIENL
YARRGTERPNLCFAGHTDVVPVGDSAAWTQGPFEAEIQDGMLYGRGAVDMKSAIAAFVAA
VSNLPRDLPGSLSFLITGDEEGVAEDGTVRVVQALAAEGEVIDHCIVGEPTSANLLGDMV
KIGRRGSINAWIAVDGRQGHVAYPQRAANPIPVMVDILSRLQSRVLDEGYEGFQPSNLEV
TTIDVGNTATNVIPASAKARINIRFNPAHQGKDLRAWIEQECRDAADGFSGRVEALCKIG
GEAFLTQPGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRSLCPVVEFGLVGATMHAV
DERVPVQEIRDLANIYQALIGRYFAAFA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccagccccgctcccgaacctgtcagcatcgactccgtcgccctcgcccaggcc
ctgatccgccgtccgtccgtgaccccggccgacgaaggggcgatggacgttctgcaacgc
cagctggaggccctgggcttcaactgccgccgcatgaagttcggcgagatcgagaacctc
tacgcccggcgcgggacggagcgccccaacctctgcttcgcgggccacaccgacgtggtg
ccggtcggcgacagcgcagcttggacgcagggtccgttcgaggccgagatccaggacggc
atgctctacggccgcggcgcggtcgacatgaagagcgccatcgccgccttcgtcgccgcg
gtttcaaatctgcctcgagatcttccaggctcgctgagcttcctgatcaccggcgacgag
gagggcgtggccgaggacggcaccgtccgcgtcgtccaggccctggctgccgagggcgag
gtcatcgaccactgcatcgtcggcgaacccaccagcgccaacctgctgggcgacatggtc
aagatcggccggcgcggcagcatcaacgcctggatcgccgtggacggtcggcagggccac
gtggcctatccgcagcgcgccgccaacccgatcccggtgatggtcgacatcctctcgcgc
ctgcaaagccgggtgctggacgagggctatgaaggcttccagccctcgaacctggaggtg
accacgatcgacgtcggcaacaccgccaccaacgtcatccccgcctcggccaaggcccgg
atcaatatccgcttcaaccccgcccaccagggcaaggacctgcgggcctggattgaacag
gagtgccgcgacgccgccgatggcttttccggccgggtcgaggccctgtgcaagatcggc
ggcgaggcctttctgacccagccgggcgccttcaccgacgtgatcgtggccgccgtcggc
gacgccaccggccgcgtcccggagctgtcgaccaccggcggcaccagcgacgcccggttc
atccgcagcctgtgcccggtggtcgagttcggcctggtcggcgccaccatgcatgcggtc
gacgaacgcgtgccggtgcaggaaatccgggacctcgccaacatctaccaggccctgatc
ggccgctatttcgcggccttcgcctga

DBGET integrated database retrieval system