KEGG   Caulobacter sp. K31: Caul_4582Help
Entry
Caul_4582         CDS       T00651                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
cak  Caulobacter sp. K31
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cak00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cak02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4956717..4957403
Genome map
AA seq 228 aa AA seqDB search
MSDLTFNKIFGGVLMTGLIIFGLKEASDIVFEKHELEKPGYEIAVAEEAGPAGAAAEVAP
DWGSVLLVPANIAAGKEITAKCTSCHSFAQGGGTIVGPDLFGVVGRKPGAHPGMAYSPAM
IEFGAKNPVWDYDHLDTFLKAPGKDVSGTKMTFVGLKKQEDRIAVIAYLHSLGSTLPVPA
PKPAGAAPAAAPAEGAAAPAAGAAPAPAAAGTPVAGAPATPAPAAAKS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctgacgttcaacaagatcttcggcggcgtcctgatgaccggcctgatcatt
ttcggcctcaaggaagcgtcggacatcgttttcgagaagcacgagctcgagaagcccggc
tacgagatcgccgtcgccgaagaggctggtccggccggcgccgcggccgaggtcgcgccc
gactggggcagcgtcctgctggttccggccaacatcgcggccggcaaggaaatcaccgcc
aagtgcacctcgtgccacagcttcgcccagggcggcgggacgatcgtcggtcccgacctg
ttcggcgtcgtcggccgcaagccgggcgcgcatccgggcatggcctattcgcccgccatg
atcgaattcggcgccaagaacccggtctgggactacgaccacctcgacaccttcctgaag
gcgccgggcaaggacgtctcgggcaccaagatgacgttcgtcggcctgaagaagcaggaa
gaccggatcgcggtcatcgcctatctgcacagcctgggctcgaccctgccggtgccggct
cccaagccggccggcgcggcccctgccgccgctcccgccgagggcgccgctgctccggcg
gccggcgcggccccggctccggccgccgcgggaaccccggtcgccggcgcgccggccact
ccggccccggccgccgccaagtcctga

DBGET integrated database retrieval system