KEGG   Caulobacter sp. K31: Caul_4839Help
Entry
Caul_4839         CDS       T00651                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cak  Caulobacter sp. K31
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caul_4839
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caul_4839
   00650 Butanoate metabolism
    Caul_4839
  Energy metabolism
   00190 Oxidative phosphorylation
    Caul_4839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5237892..5238299)
Genome map
AA seq 135 aa AA seqDB search
MANPSSAGRFRTPMSRARGLGASRHGVAHFITERVSGVALIPLALWGLFAALRLASLGFD
GAAEWVAIPCNAALLCLLLVVALIHLKGAVQVVIEDYIADFTLKTVLVLANLFVCVLGGV
LGVVAILKVAFTGAF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccgtcttccgccggccgtttccgcacgccgatgtcccgggcccggggtctg
ggcgcctcgcgccatggcgtcgcccacttcatcaccgagcgcgtctcgggcgtcgccctg
atccctctggccctgtggggcctgttcgccgcgcttcgcctggccagcctgggcttcgac
ggcgccgccgaatgggtggccatcccgtgcaacgccgccctgctctgcctgctgctcgtc
gtcgccctgatccatctcaagggcgcggtgcaggtggtgatcgaggactacatcgcggac
ttcacgctcaagaccgtgctggtcctcgccaatctttttgtttgcgtcctcggcggcgtt
cttggggtcgtggcgatcctcaaggtcgccttcaccggagccttctga

DBGET integrated database retrieval system