KEGG   Caulobacter sp. K31: Caul_4936Help
Entry
Caul_4936         CDS       T00651                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cak  Caulobacter sp. K31
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Caul_4936
   00052 Galactose metabolism
    Caul_4936
   00500 Starch and sucrose metabolism
    Caul_4936
   00520 Amino sugar and nucleotide sugar metabolism
    Caul_4936
Enzymes [BR:cak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Caul_4936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5334052..5334918)
Genome map
AA seq 288 aa AA seqDB search
MKPVRKAVLPVAGFGTRVLPGTKTTPKELLNVVDRPILSYIVEEGRAAGIEHFVFVTGRN
KGAIEDYFDHQVELEAALAAKGKTALLEELLGELPKPGEMSFVRQMAPLGLGHAVWCARD
IIGDEPFAVMLPDMVMSASKPALAQAIEAYDQKGGNIVVVEPAPEGMAHQYGIVALDGQD
GRLNRMTGMVEKPPKGTEPSNLFISGRYILQPEIFDLLAQQGKGAGGEIQLTDSMLSLLR
TQDFHALEYEGETYDCGDKIGLLRANVAMALKRPDLADAARAMIQGLL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtccgcaaagccgttctccccgtcgccggtttcggcacccgggtcctgccc
ggcaccaagaccacgcccaaggagctgctcaacgtcgtggacaggccgatcctgtcctac
atcgtcgaggaaggccgggcggcgggcatcgagcacttcgtgttcgtgaccggccgcaac
aagggcgcgatcgaggactatttcgaccatcaggtcgaactggaggctgcgctggcggcc
aagggcaagaccgcgttgctggaagaactgctcggcgaactgcccaagcccggcgagatg
agcttcgtgcgtcagatggccccgctgggcctgggccacgcggtgtggtgcgctcgcgac
atcatcggcgacgaacccttcgcggtgatgttgcccgacatggtgatgtcggccagcaag
ccggccctggcccaggccatcgaggcctatgaccagaagggcggcaacatcgtggtggtc
gagcccgccccggaaggcatggcgcaccagtacggcatcgtggccctggacggccaggac
ggccgcctcaaccgcatgaccggcatggtcgagaagccgccgaaggggaccgagccctcg
aacctgttcatctcgggccgctacatcctgcagccggaaatcttcgacctgctggcccag
cagggcaagggcgccggcggcgagatccagctgaccgactcgatgctgtccctgctgcgc
acccaggacttccacgccctggaatacgagggtgaaacctacgactgcggcgacaagatc
ggcctgctgcgcgccaatgtcgccatggccctgaagcggccggatctggccgacgcggct
agggcgatgatccagggactgctgtag

DBGET integrated database retrieval system