KEGG   Caulobacter sp. K31: Caul_4958Help
Entry
Caul_4958         CDS       T00651                                 

Definition
RNA polymerase factor sigma-54
Orthology
K03092  
RNA polymerase sigma-54 factor
Organism
cak  Caulobacter sp. K31
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:cak00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Caul_4958
Transcription machinery [BR:cak03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Caul_4958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5360746..5362254
Genome map
AA seq 502 aa AA seqDB search
MALGHRLELRQGQGLVITPQLQQAIKLLQLSNLELDAFVEAELERNPLLQREDGPVEAER
APEDVERAPENLGLDSVSDSAASVQMDATPDDVSPGERATGDGPDSEGGAEQAGGQIDWS
RTGGGGNFESDDNYESALSRAPTLCEHLTEQLAVAGLTAAQNVVAGVLIDAVDETGYLRA
DLLEVAERLGCGLDFVEGVLTVLQGFEPAGVMARDVRECLALQLKDVNRYDPCMAALLDN
LDLLAKRDMASLRKVCGVDDEDLREMVAEIRALTPRPGAAFHADPPQTLVPDVHVRETPG
GLWHVELNTDTLPRVLVDQRYHARVSKGARTDQEKTFVSDSFATANWLVKSLDQRAKTIL
KVSSEIVRQQDGFLAYGVEHLRPLNLKTVADAIGMHESTVSRVTSNKYIATPRGVFELKY
FFTSAIQSSEGGEAHSAASVRYKIKGLVEAERTEADVHSDDRIVEILKDAGVDIARRTVA
KYREALRIPSSVERRRLIKETA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
ttggctctcggccacagattggagcttcggcaaggccaaggccttgtcatcacgccgcag
cttcagcaggcgatcaagctgctgcagctgtcgaacctcgagctcgacgccttcgtcgag
gccgagctcgagcgcaaccccctgctccagcgcgaagacggtccggtcgaggccgaacgc
gcgcctgaagacgtcgagcgcgcgcccgagaacctcggcctggactcggtgtccgacagc
gccgccagcgtccagatggacgccacgcccgacgacgtctcgcccggcgagcgcgccacc
ggcgacggcccggactctgaaggtggagccgagcaggccggcggccagatcgactggtcg
cgaaccggcggcggcggcaatttcgagagcgacgacaattacgaaagcgccctgtcgcgc
gccccaaccctttgcgagcacctgaccgagcagttggccgtggccggcctgaccgccgcc
cagaacgtggtggccggggtgctgatcgacgcggtcgatgagaccggctacctgcgcgcc
gacctgctcgaagtggccgagcgcctgggctgcggcctggatttcgtggaaggcgtgctg
accgtcctgcaaggcttcgagcccgccggcgtcatggcccgcgacgtgcgcgagtgcctg
gccctgcagctgaaggacgtcaatcgctacgacccgtgcatggccgccctgctcgacaat
ctcgacctgctggccaagcgcgacatggcgtccctgcgcaaggtctgcggcgtggacgac
gaggacctgcgcgagatggtcgcggagatccgcgccctgacccctcgccccggcgcggcc
ttccacgcggacccgccccagaccctggtgcccgacgtccatgtccgcgagacgcccggc
ggcctgtggcacgtcgagctgaacaccgacaccctgccccgggttctggtcgaccagcgc
taccacgcccgggtcagcaagggcgcgcgcaccgaccaggaaaagaccttcgtctccgac
agcttcgccaccgccaactggctggtcaagagtctcgaccagcgggccaagaccatcctg
aaggtgtccagcgagatcgtccgccagcaggacggcttcctggcctatggcgtcgaacat
ctgcgcccgctgaaccttaagaccgtcgccgacgccatcggcatgcacgagagcaccgtc
agccgggtgacctccaacaagtacatcgccaccccgcgcggggtgttcgaactgaaatat
ttcttcacctcggccatccagtccagcgagggcggcgaggcccattcggccgccagcgtg
cgctacaagatcaagggcctggtcgaggccgagcgcaccgaggccgacgtccattccgat
gaccgcatcgtcgagatcctcaaggacgccggcgtcgacatcgcccgccggacggtggcc
aagtatcgagaagccctgcgtattccgtcctccgtcgagcgtcgccgcttgatcaaggaa
accgcctga

DBGET integrated database retrieval system