KEGG   Caulobacter sp. K31: Caul_4977Help
Entry
Caul_4977         CDS       T00651                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cak  Caulobacter sp. K31
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caul_4977
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caul_4977
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caul_4977
Enzymes [BR:cak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Caul_4977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5381636..5382463
Genome map
AA seq 275 aa AA seqDB search
MTKDRIDRRFAALKAENRAGFVTYIMAGDPDAATTLSVLKGLPAAGADLIELGFPFSDPM
AEGPTIQRAAQRGLKSGMTLQGTLDLVAGFREGDADTPIILMGYLNPVLNRGFESFAAAA
AKAGVDGLIIVDCPPEEAGPLTDALEAEGIALIRLAAPTTDDKRLPMVVRRTSGFVYYVS
VAGVTGVKSADAADVAPAVARLRKASGLPVAVGFGIRTPAQAAAVARVADAAVVGSALVD
EIEAAAQLNENVTEKVLLKASELAKAVRSARLELA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaggaccgcatcgaccgccgtttcgcggctttgaaagccgagaaccgcgctggc
ttcgtgacctatatcatggccggcgatcccgacgccgccacgacgctcagcgtgctcaag
ggcctgccggcggccggcgccgacctgatcgagctgggctttcccttctccgacccgatg
gccgagggtccgaccatccaacgcgccgcccagcgcggcctgaagtccggcatgacgctg
cagggtacgctcgacctagtcgccggcttccgcgaaggcgacgccgacaccccgatcatc
ctgatgggctacctcaacccggtgctgaaccgcggcttcgaaagcttcgccgccgccgcc
gccaaggccggggtcgatgggctgatcatcgtcgattgccctccggaagaagcgggaccc
ctgaccgacgccctggaagccgaggggatcgccctgatccgcctggccgcccccaccacc
gacgacaagcgcctgccgatggtcgtgcgccgcacctcgggcttcgtgtattacgtttcg
gtggcgggcgtgaccggcgtcaagtcagccgacgccgccgacgtggccccggccgtggcc
cggctgcgcaaggcctcgggcctgccggtggccgtcggcttcggcatccgcacccccgcc
caggccgccgccgtggcccgcgtggccgacgcggccgtggtgggctcggccctggtcgac
gaaatcgaggcggcggcccagttgaacgaaaacgtgaccgagaaggttcttctcaaggcg
tcggagctggctaaggctgtgcgatcggcgcgactcgaattggcgtga

DBGET integrated database retrieval system