KEGG   Candida albicans: CaJ7_s006Help
Entry
CaJ7_s006         CDS       T00189                                 

Definition
hypothetical protein
Orthology
K03946  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
cal  Candida albicans
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    CaJ7_s006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 92 aa AA seqDB search
MSKFVIPTALKELRFHLSQTGEASIPVRNFLTKNYPSLKTQSNYKLPILIRESYGIPPTL
TARFERGEEVKTSLEGLDEAGVEKALNELLKR
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtttgttattccaactgccttaaaagaattaagatttcatttatcacaaaca
ggagaagcttcaatacctgtgagaaactttttaactaaaaactatccaagtttgaagact
caactgaattacaaattaccaattttgattagagaaagttatggtatcccacctacatta
actgctagatttgaaagaggtgaagaagtgaaaacaagtttagaaggtttggatgaagct
ggtgttgaaaaggcattaaatgaattattaaaaagatag

DBGET integrated database retrieval system