KEGG   Candida albicans: CaO19.10052Help
Entry
CaO19.10052       CDS       T00189                                 

Definition
similar to N terminus of S. pombe SPAC17H9.14c putative protein disulfide isomerase (EC 5.3.4.1); one of two genes similar to S. cerevisiae PDI1 (YCL043C)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cal04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 221 aa AA seqDB search
MMKLLSIITTVLYFFTFLVSSYTTSNIIQANDNNLQSLIKTRGKFSFVDFYADWCRHCKK
ISPIIDELSELFIDYPEIQIIKINGDKDGKKMSKKYVDIGYPTLLFFYDDGRKIEFDGIR
DLTSLSNFIQQLSGIRLNESKSTDNNEEEEEEKKEKKESSSSGSSSNVNDADEETNKLIE
LTPENFDEKVSQSPISIVSFGASWCKYCQELDTALDKLANE
NT seq 664 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacttttatcaataataacaacagtgttatatttcttcacattcttggtatca
tcatatacaacatcaaatatcattcaagcaaatgataataatttacaatcacttataaaa
actcgagggaaattttcatttgttgatttttatgctgattggtgtcgtcattgtaaaaaa
atttcacccattatagatgaattaagtgaattatttattgattatcctgagattcaaata
attaaaattaatggtgataaagatgggaaaaaaatgagtaaaaaatatgttgatattgga
tatccgacattattatttttttatgatgatgggaggaaaattgaatttgatggaattaga
gatttgactagtttaagtaattttattcaacaattaagtgggattagattaaatgaaagt
aaatcaactgataacaatgaggaggaggaggaggagaagaaggagaagaaagaaagtagt
agtagtggtagtagtagtaatgtaaacgatgcagatgaggaaacgaacaaattgattgaa
ttgactccggaaaattttgatgaaaaagtatcacaatcaccaatatctattgtatcattt
ggagcatcatggtgtaaatattgtcaagaattagatacagcattagataaattagccaat
gaag

DBGET integrated database retrieval system