KEGG   Candida albicans: CaO19.10074Help
Entry
CaO19.10074       CDS       T00189                                 

Gene name
SAS3
Definition
potential histone acetyltransferase similar to S. cerevisiae SAS3 (YBL052C) catalytic subunit of the HAT complex NuA3
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 805 aa AA seqDB search
MVSHLLNQLKITNNHIYSNIVPQDLDKRTIRAKPTNDYSLKSMIKNNTHQKSTIPITNTT
KIKSVHDDSNSNIKRVKRSFKHNNIFVKLTKKKCIVVINYDKTKLSTITRSKLDTVPLLP
NSTSFTSENQNQNQVDTSILSEIQLPYKGILKYPDCIINDTDPTKLDTERFNKYLDEGIK
LRNKTTCHLETETETETETETKTEIETELQSQVFSNLLHPILNESNQSTESTPVPNYSNL
NKSKINRIVLRDFEINTWYIAPYPEEYSQCEVLYICEYCLKYMNSPMSYRRHQLKNCNFS
NNHPPGLEIYRDQKSKISIWEVDGRKNINYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLT
EIDEKNPSNYHFVGYFSKEKLNSSDYNVSCILTLPIYQRKGYGNLLIDFSYLLSRNEFKY
GTPEKPLSDLGLLSYRNYWKVTIAYKLKQIYDKYFSCNANGDGDSVSDNARLSLSIDTLC
KLTGMIPSDVIVGLEQLDSLARNPITHNYAIVINLDKINTEIAKWEKKSYTKLVYEKLLW
KPMLFGPSGGINSAPSIQPPQPQSTSVTTTTMSAREGTTNSHPKPVIPQNSISLITNFLK
DDINNPYTFEEEGFKEIEAHRETENEEIKNASLVEYVTCYPGIVVNNHFVNGGGGSGESN
GSNDQIKGHKKMLKKRKRIIDDDDDDDDDDDDDDDEIEKIFEIDEIPSNDENEPDFEDDS
DDVDDFMDDDEEEVVEIKDNDSDEDVSEDIIEILDDDDQEEEDWRRTWKRRVPSPPKRKT
VNVLTGNNNKPRGRGRPRGTFKLKA
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggttctgcacctactaaatcaattaaaaattaccaataaccatatttattccaatata
gtgccgcaagatttggataaaagaaccattcgagccaagcccaccaatgattattctttg
aaaagtatgataaaaaataatactcatcaaaaactgactataccaataacaaacaccacc
aaaataaaatctgttcatgatgatagcaacagcaatatcaaaagagtgaagaggagtttc
aaacataacaatatttttgtcaaattaacgaaaaagaaatgtattgttgttattaattat
gacaaaacaaaactatcgacaataaccagatcaaagttagatactgtaccattactaccc
aatagtacatcatttacactggaaaaccaaaaccaaaatcaggtagatacatctatattg
tcagaaatacagttaccttataaaggtatattaaagtacccagattgtattatcaatgac
actgaccccacaaaactagatacagaaaggtttaacaaatatctcgatgaagggataaaa
ttgcgaaataaaaccacttgccatttggagacagagacagagacagagacagagacagag
acaaagacagagatagagacagaattacagtcacaagttttttctaatttactccatcca
atactaaatgaatcaaatcaaagtacagaatctactccggtgcctaattattcaaattta
aacaaatcgaaaataaatcgaatagtactaagagactttgaaatcaatacctggtatatt
gctccatatccagaagaatattcacaatgtgaagtattatacatttgtgaatattgtctc
aaatatatgaattcaccaatgtcttaccgacgacatcaattgaaaaattgtaatttttca
aacaatcatcctccaggattagaaatttatcgagatcaaaaaagtaaaattctgatttgg
gaagttgatggaaggaaaaacattaattattgtcaaaatttatgtttattagccaaatta
ttcctcaattcaaaaacattgtattatgatgtcgaaccattcattttttatgtattgaca
gaaattgatgagaaaaacccatcaaattatcattttgttggatattttctgaaggagaaa
ttgaatagctcagattataacgtctcatgtattttaactttacccatttatcaaagaaaa
gggtatggtaatctattgattgatttcagttatttattaagtcggaatgagttcaagtat
ggaacaccggaaaaaccattaagtgatttgggtttactaagttatagaaattattggaaa
gtaacaattgcttataaattgaaacaaatttacgataaatacttttcatgcaatgccaat
ggggatggtgacagtgtcagcgacaatgcaaggctcagtttatctattgatacactttgt
aaattgactggcatgataccatctgatgttattgttgggctagaacaattagattcatta
gcaagaaatccaataactcataattatgccattgtgattaacttggataaaatcaacact
gaaattgctaaatgggagaaaaaactgtatactaaactagtctatgagaaattattatgg
aaaccaatgttatttggtccaagtggaggaatcaattctgcaccatcaattcaaccacca
caaccacaatcaacatcagtaacaacgacaacaatgtcagctagagaaggtactacaaat
tctcacccaaaaccagttattcctcaaaatagtatttcattaatcacaaactttttaaaa
gatgacatcaacaatccttacacatttgaggaagaaggatttaaagaaattgaagctcac
agagaaactgaaaatgaagagataaagaatgcaagcttagtagaatatgttacttgttat
cctggcatagtagtgaacaatcatttcgtcaatggtggtggtggtagtggtgaactgaat
ggctcaaatgatcaaatcaagggccacaaaaagatgttgaagaaaaggaaaagaattata
gatgatgatgatgatgatgatgatgatgatgacgatgatgacgatgagattgaaaaaata
tttgaaattgatgagatcccgagtaacgacgaaaatgaacccgattttgaagatgacagc
gacgatgtggatgattttatggatgatgatgaagaagaagtagtggagattaaagacaat
gattccgatgaggatgtatctgaagatataattgaaattttggacgatgacgaccaagag
gaagaagactggagaagaacttggaaacgaagggtaccatcacctcccaaaaggaaaact
gtcaatgtattgactggcaacaataacaaaccaagaggtagagggagaccaagaggaaca
ttcaaattaaaagcttaa

DBGET integrated database retrieval system