KEGG   Candida albicans: CaO19.10137Help
Entry
CaO19.10137       CDS       T00189                                 

Gene name
HDA1
Definition
strong similarity to S. cerevisiae HDA1 (YNL021W) class II histone deacetylase HDA1 complex subunit
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CaO19.10137 (HDA1)
Protein phosphatases and associated proteins [BR:cal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CaO19.10137 (HDA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 833 aa AA seqDB search
MSTGQEEHLDSKLENQISEEENQSQNQNFPTAIEDSIQASIEKLDEVDDEINPIEVKDEF
PTTIGTTYDILHPREPFPKRIKLEETETEPDSNGIADNDQTMVVVPPKKPQLFYTPLKTG
LVYDVRMRYHAKVFTSYSEYIDPHPEDPRRIYRIYKKLVEAGIVLDPSLAGINEIGPFML
KIPIREATSEEILQVHSEDHLKFIQSTEDMSRDQLLKETETGDSIYVNNDSYLSAKLSCG
GTIEACKAVIEGRVKNSLAIVRPPGHHAEPNTPAGFCLFSNVAVAAKNMLKNYPESVRRI
VIVDWDIHHGNGTQKAFYNDPRVLYISLHRFENGKFYPGTKYGDLNQVGEGPGEGFTINI
PWRSSGMHDGDYVYAFNKIIQPVISEFDPDLIIVSSGFDAADGDVIGACHVTPAGYGYMT
HTLKGIARGKLAVILEGGYNLDSISKSALAVAKVLVGEPPENTITLRPQAEAIEVVDEVI
KIQSKYFKSLRNGIPNGIFEDVYDLADVEKSNYKLVNIADPIRSHQVEKLFNEKEFINIP
IISSPSNGEKPPFTTDLPDQLEDLIVASPDIYNCTTIILTIHDPPEIWANINPTNGVIET
NSTMVLEHPLVQIMDKIQKEKDPENQEKFGYLDINIPSFQLPIPGTTSESSTYNPIIFAQ
EVLLYIWDNYIAYFQQLKNLVMVGFGDSYQSIVNLYGKRPSNEIKDLIKGTVAFLNRTTL
KPLIPVMDESMVDWYYQNSIIFTSNFNTCWTGGSGAGNGNGNGNGNNGNSSNGGGNKSAD
SNGHDDFSKRPRKKFGRVIKAKTDGLCDVIQEKFDEGVDFILDSIEDYSSSED
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggtcaagaagaacatctagattctaagctagaaaatcaaatctcagaggaa
gaaaatcaaagtcaaaatcaaaattttccaactgcaattgaagattctatacaagccagt
attgaaaaattggatgaagtagatgacgaaatcaatcctattgaagtaaaagatgagttt
cctactactattggtactacttatgatatcttacatccacgagaaccatttcccaagaga
ataaaattagaggaaaccgaaactgagccagattctaatggtattgccgacaatgatcaa
actatggttgtagttccacccaaaaaaccacaattattttataccccattgaaaacagga
ttagtttatgatgtgagaatgagatatcatgctaaagtattcacatcctatagtgaatac
attgacccacatccagaagatcctcgtcgaatatacagaatttataaaaaattggttgaa
gctggtatagttctcgatccttctttagcaggaattaatgaaattggaccgtttatgtta
aaaattcctattcgagaagcaacatccgaagaaattttacaagttcattctgaagatcat
ttaaaatttattcaatctactgaagatatgtcaagagatcaattgctcaaggaaacagag
accggagattctatttacgttaacaatgactcctatttgtcagcgaaattatcctgtggt
ggtactattgaagcatgtaaagcagttattgaggggagagtgaaaaattctttagcaata
gtgagaccaccaggtcatcatgctgagcccaatacaccagcaggattttgtttatttagt
aatgtcgcagtggcagcaaaaaatatgttgaaaaattatcctgaatcagttcgaagaatt
gttattgtggattgggatatccatcatggaaacggaacccaaaaagcattttataatgat
ccaagagttttatatatttctttgcatagatttgagaatggaaaattttatccagggaca
aaatatggtgatttaaatcaagttggggagggcccaggggaagggttcaccataaatatt
ccttggagatcttctggtatgcacgacggtgattatgtttatgcattcaataagataata
caaccagtaatttccgaatttgacccagatttaattattgttagttctggatttgatgct
gctgatggagatgtgattggtgcctgtcatgtaacaccagccggatatggatatatgacc
catacgttaaaggggatcgccagaggaaaattggctgttattttagagggtggctataat
ttagactctattagcaagagtgcgttggcagtagccaaagtattggtcggcgaaccaccg
gaaaatacaatcactttacgcccgcaagcggaggctatcgaagttgttgacgaagtgatc
aagatacaatccaaatactttaaatctttgagaaacggaattccaaatggtatatttgaa
gatgtttatgatttagcggatgtagaaaaatcaaactacaaattggtaaatattgctgat
ccaatcagaagtcatcaagtggaaaagttattcaacgaaaaagaatttatcaatattcca
atcatcagttctccatctaatggtgaaaaacccccattcacaacggatttaccggaccaa
ctagaagatttgattgttgcaagtcccgatatttataattgtaccacgataatactaaca
atacacgacccaccagaaatatgggccaatataaatccaacaaatggagtcattgaaacc
aattctaccatggttttggaacatcctttagtacaaataatggacaaaatacaaaaggaa
aaggatccagagaatcaagaaaaatttgggtatttagatatcaatatcccatcattccaa
cttccgatcccagggacaacatctgaatcgtctacttataatccaattatttttgctcaa
gaagttttgctttatatttgggataactacatagcgtatttccaacaattgaagaacctt
gttatggttggttttggcgacagttatcaatcaattgtgaatttgtatggcaagagacca
tcaaacgaaataaaagatttgatcaaggggacagtggcgtttctaaaccgaacgacattg
aaaccattgatcccagtgatggatgaatcaatggtggattggtattatcaaaattcaatt
attttcacaagtaactttaacacatgctggactggcggcagtggtgctggtaatggcaat
ggaaatggaaatggtaataatggaaatagttcgaacggtggaggtaacaagtcagcagac
tcaaatggacatgatgattttagcaaacgtccaagaaaaaaatttggcagagtaatcaaa
gcaaaaacagatggattatgtgatgtcatacaagaaaaattcgatgaaggagtagatttc
atattagattcaattgaagactactcctcttccgaagattga

DBGET integrated database retrieval system