KEGG   Candida albicans: CaO19.10187Help
Entry
CaO19.10187       CDS       T00189                                 

Gene name
NCP1
Definition
NADP-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 680 aa AA seqDB search
MALDKLDLYVIVTLVVAVAAYFAKNQFLSKPQDTGFLSNDGAGGSSRNILETLKKNNKNT
LLLFGSQTGTAEDYANKLSRELHSRFGLNTMVADFADYDFDNFGDITDDILVFFIVATYG
EGEPTDNADEFHTWLTDEADTLSTLRFTVFGLGNSTYEFYNAIGRKFDQLLEEKGGERFA
EYGEGDDGTGTLDEDFLSWKDGVFDSLKNNLNYEEKELKYEPNVKLTERDDLTVDDSNVS
LGEPNKKYINSQGVDLSKGPFDHTHPYLAKITKTKELFNSKDRNCVHVEFDISDSNLKYS
TGDHLAVWPSNSDENIKQFLKCFGLEDKENTVIELKALDSTYSIPFPSPITYGAVIRHHL
EISGPISRQLFLSIAGFAPNEETKATLTRIGNDKQEFASTITRRKFNIADALLFASKGKA
WVDVPFEFIIENVQHLTPRYYSISSSSLSEKQLINITAVVEAEVESDGRAVTGVVTNLLK
NIEIEQNNTNETPVVHYDLNGPRNKFSKFKLPVHVRRSNFKLPKNTTTPVILIGPGTGVA
PLRGFVRERVQQVKNGVNVGKTILFYGCRNEHDDFLYKQEWSEYASVLGDKFEMFNAFSR
QDPSKKVYVQDKIVENYKIVNELLNNGATIYVCGDASRMARDVQAAIAKIVAKDRDISQE
SATELVKSWKVQNRYQEDVW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcattagacaaattagatttatacgttatcgtgacattggtggttgcagtagcagca
tactttgccaagaaccaattccttagcaaaccacaagacactggatttctttccaatgat
ggtgctggtggaagttcaaggaacatattggagacgttgaagaagaataataaaaacacg
ttattactatttggatcacaaactggtactgctgaagattatgccaataaattgtctcgt
gaattgcattccagatttgggttgaacaccatggttgccgattttgctgattatgatttt
gataattttggagatatcacagacgatatattggtgtttttcattgtcgctacttatggt
gaaggggaacctactgataacgccgacgaattccacacttggttaaccgatgaagctgat
actttgagtactttgagatttactgttttcggattaggtaactccacttatgagttttat
aacgctattggtagaaaatttgaccaattattggaagaaaaaggaggtgaaagatttgct
gaatatggtgaaggtgatgacggtactggtactttggacgaagatttcttatcttggaaa
gatggtgtttttgattcattgaagaataatttgaattacgaagaaaaagagttgaaatat
gaaccaaatgtcaaattgactgaacgtgacgatttaactgttgatgactctaatgtttcc
cttggtgaaccaaataaaaagtatattaactctcaaggcgttgatttaagcaaaggtcca
tttgatcacacacacccatatttagccaagataacgaaaacaaaggaattattcaattct
aaagatagaaattgtgtccatgttgaatttgatatttctgactccaacttgaaatacagc
actggtgatcatttagctgtttggccatctaattccgatgaaaatatcaaacaattcctt
aaatgttttggtttagaagacaaggaaaacaccgttatagaattgaaggcattagactcc
acttattccattccattcccaagcccaattacctatggtgctgttatcagacatcatttg
gaaatttctggaccaatttcgagacaattattcttatccattgccgggtttgccccaaat
gaagagacaaaggctacattaactagaatcggtaacgataaacaagagtttgcttctaca
attacccgtagaaagtttaatattgccgatgcattgttgtttgcttccaaaggtaaagct
tgggttgatgttccatttgaatttattattgaaaatgttcaacatttgacacctcgttac
tactcgatttcttcttcatctttaagtgaaaaacaattgatcaatattactgctgttgtt
gaagctgaagttgaaagtgacggtagagctgttactggggttgttactaatttattgaaa
aacattgagattgaacaaaataacaccaacgaaaccccagtagttcattatgatttgaat
ggtccaagaaacaaatttagcaagtttaaattacctgttcacgttagaagatccaatttc
aaattaccaaagaatactaccactcctgttattttgattggaccaggaactggtgttgct
ccgttgagaggattcgttagagaaagagtccaacaagttaagaatggcgtgaatgttggt
aaaactattttattctatggttgcagaaacgaacatgatgatttcttgtataaacaagaa
tggtctgaatatgctagtgtattaggtgacaaatttgaaatgttcaatgctttttcaaga
caagatccatcgaagaaagtatatgtacaagataaaattgtggaaaattacaaaattgtt
aatgaattgttaaacaatggtgccactatctacgtttgtggtgatgccagtagaatggca
agagatgttcaagcagcaattgctaaaattgttgccaaagatagagatatctcacaagaa
agtgctactgaattggtcaaatcttggaaagtacaaaacagatatcaagaagatgtttgg
taa

DBGET integrated database retrieval system