KEGG   Candida albicans: CaO19.105Help
Entry
CaO19.105         CDS       T00189                                 

Gene name
HAL22
Definition
one of two closely related genes similar to S. cerevisiae MET22/HAL2 (YOL064C) bisphosphate-3'-nucleotidase, implicated in salt tolerance and methionine biogenesis; both genes have gaps compared to C. albicans GenBank sequence (AY035375)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cal  Candida albicans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CaO19.105 (HAL22)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CaO19.105 (HAL22)
Transfer RNA biogenesis [BR:cal03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CaO19.105 (HAL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 393 aa AA seqDB search
MKTLFISTLFILLVSLLFTYKPLTTRLNLFTRFISMSHSTHPYQKELEVATLAVKRASLL
TKQLSDSIVQTAKSGTLTKDDKSPVTIGDFASQAIINHAIKLNFPNDEIVGEEDSRELQE
NTGLADQMLQLITKIQKETSGYNDIVGTLTDKNEVYQSIDFGNSQGGSKGRFWALDPIDG
TKGFLRGDQFAVCLALIEDGKVVLGVIGCPNLSENIVSNEEHSGVVGGLYSAVKGVGSFY
SDLFKEGAEPLSQQKRIKMQNHTNPSQLKVVEGVEKGHSSHSTQAEIKAKLGFDSATVAK
QTINLDSQVKYCVLASGQADIYLRLPVSDTYREKIWDHAAGNILIYESGGQVGDVTGSPL
NFGNGRTLDSKGVIAANKEIFDKVIDAVTEVRK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattattcatctcaacactcttcatattgcttgtatcattacttttcacatat
aaaccactcaccaccagactaaatttattcactcgtttcatcagcatgtcccattctact
cacccataccaaaaggaacttgaagttgcaactttagcagtaaagcgtgcctcattgctc
actaaacaattaagtgattccattgtgcagactgccaagtcaggcacactcactaaagat
gacaagtcacccgtgactattggagattttgctctgcaggctattatcaaccatgccatt
aaattgaatttcccaaatgacgagattgtgggtgaagaagattcacgggaattacaggaa
aacactggcttggctgaccaaatgttacaactaatcaccaagatccaaaaggaaaccagc
ggatataacgacattgttggaacattgactgacaagaacgaggtgtatcagagtattgat
tttggaaactcacaaggcggtctgaaggggagattctgggcattggacccaattgatggg
accaaaggattcctcagaggtgaccaatttgcagtgtgtttggcattgattgaagatggg
aaagtggtattaggtgttattggatgtccaaacttactggaaaacattgtatcgaacgaa
gaacattcaggggttgttggtgggttgtactctgctgtcaaaggagttggctcattctac
agtgatttgttcaaagaaggtgctgagccattgtcacagcaaaaacgaatcaaaatgcaa
aaccatacaaaccctagccaattgaaggttgttgaaggtgttgaaaaaggtcattcttcg
cattcaacccaagctgaaatcaaagccaagcttggatttgacctggcaactgttgcaaaa
caaactatcaacctcgactcacaagtcaaatactgtgtgttggcaagtggacaagcagac
atctacctcagattgccagtaagcgatacataccgtgagaaaatctgggaccatgccgct
ggtaatatcttgatatacgagagtggtggtcaagttggtgatgtcactggttcaccattg
aattttgggaatggcagaacattagattccaaaggtgttatcgccgccaacaaggagata
tttgataaggttatagatgcagttactgaagtgagaaagtga

DBGET integrated database retrieval system