KEGG   Candida albicans: CAALFM_C104180WAHelp
Entry
CAALFM_C104180WA  CDS       T00189                                 

Gene name
CaO19.1052
Definition
(RefSeq) hypothetical protein
  KO
K11252  
histone H2B
Organism
cal  Candida albicans
Brite
Chromosome [BR:cal03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CAALFM_C104180WA (CaO19.1052)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CAALFM_C104180WA (CaO19.1052)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 130 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTDGAKKRTKARKETYSSYIYKVLKQTHPDTGISQ
KAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSASN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaagcagaaaagaaaccagcttctaaagctccagctgaaaaaaaaccagcc
gctaaaaaaaccgcttccactgatggtgctaaaaagagaactaaagctagaaaagaaact
tattcttcatacatttacaaagttttgaaacaaactcacccagatactggtatctcccaa
aaagctatgtctattatgaactcatttgttaatgatatctttgaaagaattgcttctgaa
gcttctaaattggctgcttacaataaaaaatctaccatttctgctagagaaatccaaact
gctgttagattgatcttaccaggtgaattggctaaacatgctgtttctgaaggtactaga
gctgttaccaaatactcttctgcttctaattaa

DBGET integrated database retrieval system