KEGG   Candida albicans: CaO19.10547Help
Entry
CaO19.10547       CDS       T00189                                 

Gene name
EHD3
Definition
Member of enoyl-coA hydratase/isomerase family; similar to S. cerevisiae EHD3 (YDR036C) involved in endocytic membrane trafficking
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cal  Candida albicans
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.10547 (EHD3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CaO19.10547 (EHD3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CaO19.10547 (EHD3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CaO19.10547 (EHD3)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     CaO19.10547 (EHD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 502 aa AA seqDB search
MLRLNNSISLLKQVRKIATTSINMSSKLSTNHTSGGEEPVVLSSVKNHARLITLNRVKKL
NSLNTEMIELMTPPILEYAKSKENNVIILTSNSPKALCAGGDVAECAVQIRKGNPGYGAD
FFDKEYNLNYIISTLPKPYISLMDGITFGGGVGLSVHAPFRVATEKTKLAMPEMDIGFFP
DVGTTFFLPRLNDKLGYYVALTGSVLPGLDAYFAGFATHYIKSEKIPQLINRLADLQPPA
IEDDITVLSGNNQYFNQVNDILNDFSEKKLPEDYKFFLSTEDIATINKAFSQDTIDDVLK
YLENDGSPFARKTLETLLKKPKSSLAVGFELMNHGAKNSIKKQFELEMVSATNIMSIPAE
KNDFAKGVIHKLVDKIKDPFFPKWSDPSTVTQQFLSNILSTSKNTDKYLKTPFIKKWFGV
DFEDYPHQMGLPTNKQVADYISGSDGSNRTYLPTPAEVFKHFKQKTNNKLGVDEKIKQIL
DLHGETAKYDHKYVTWKEEPTK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttaagattaaacaattctattagtttattgaaacaagtcaggaaaatagccaccact
tctattaacatgtcatcgaaattatccaccaaccacacttctggaggtgaagagccagtt
gtattgagttcagtgaaaaaccatgctagacttatcaccctcaacagagtcaagaaattg
aattcattaaacacagaaatgattgagttgatgaccccaccaattttggaatatgccaaa
tcaaaggaaaacaatgttatcatattgacttcaaattcccctaaggctttgtgcgctggt
ggtgatgttgctgaatgtgccgttcaaatcagaaaaggaaatccaggatatggtgctgat
ttttttgacaaagaatataacctcaattatattatttctactttaccaaaaccatatatc
tcacttatggatggaatcacttttgggggaggtgttggattatcagtacatgcaccattt
cgagtagcaacagaaaaaaccaaacttgccatgccggaaatggatattggatttttccca
gatgttggtaccacattctttttacctagattgaacgataagttgggatactatgtggct
ttgacaggctctgttttacctgggttagatgcctattttgctggattcgcaactcattac
attaaatctgaaaagattcctcagttgatcaacagattagcagatttgcaaccaccagca
atcgaagatgatattacagttttgtcgggcaacaatcaatatttcaaccaagtcaacgac
attttgaacgatttcagtgaaaagaaattaccagaagactacaaattttttctttcaaca
gaagatattgcaacaatcaataaagcgttttctcaggacaccattgatgatgttctcaag
tatttagaaaatgatggatccccatttgccagaaagacacttgaaacattattgaaaaag
ccaaaaagttcattagctgtagggtttgaattgatgaatcacggagcaaagaattcaatt
aaaaaacaatttgaattagaaatggtatctgcaaccaatatcatgagtattccagcagaa
aagaatgatttcgctaaaggtgttattcataagttagtggataaaataaaggatccattt
ttcccaaagtggagtgatccaagtactgtcactcagcaattcctctcaaacattctcagc
acttcgaaaaacaccgacaaatacttgaaaactccatttatcaagaaatggtttggcgtt
gattttgaggactatccacatcaaatgggattacctacaaataaacaagtagctgattat
atttctggatctgatggatctaatagaacctatttaccaactcctgcagaagtttttaaa
catttcaaacaaaagacaaataataaattgggtgtcgacgagaagattaaacagatattg
gacttgcacggtgagaccgccaaatacgatcataagtatgttacttggaaagaagagcct
acaaaataa

DBGET integrated database retrieval system