KEGG   Candida albicans: CaO19.10583Help
Entry
CaO19.10583       CDS       T00189                                 

Gene name
DAO1
Definition
D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
cal  Candida albicans
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CaO19.10583 (DAO1)
   00330 Arginine and proline metabolism
    CaO19.10583 (DAO1)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CaO19.10583 (DAO1)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CaO19.10583 (DAO1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CaO19.10583 (DAO1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     CaO19.10583 (DAO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 361 aa AA seqDB search
MASVVVLGAGVIGLTTALELKRSNAKLDITIVADHLPGDIDHTYTSPFAGANWHSFATPE
DKRLQEIDKPGYKKFLQLAAADPRSGIWAVDNLSMYTDYEVTSNNGNYRKFVPWFKDFVD
GFEIVDKSKLPEGIAFAHKFKGVVISVHTYLNYLVQQNKEIGNVIKRIPQIHHIEDARKF
HSSGKKADYVINAAGLNASKIKGVEDKKFNFPVRGQVLLVKNNAKIQLGVEGFPGLPNEM
LYMMPRKEGGTIIGGCFLEGNTSVSEDKELTARIIKRAIKYAPELVDPNYKNNPSKIEIV
KVNVGFRPFREDDARVEVDKKYKWLIHNYGAGAGGYQGSFGLSKLVVDIMEKELSKFKSK
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcactggttgttgtattaggagctggagtcattgggttgacaacagccttggagtta
aagcgctctaatgctaaacttgatataactatagtagctgaccatttaccaggtgacatt
gatcacacatacacttcaccatttgcgggggccaattggcattcatttgcaactcctgaa
gataaacgtttacaggagattgataaacctggctacaaaaagtttttacagcttgctgca
gctgatcctagatctggtatttgggcagtagataatctttcaatgtatacagattatgaa
gtaacttcaaataacggtaactatagaaagttcgttccctggttcaaggattttgttgat
ggatttgagattgtcgataaactgaaattacctgaagggatagcttttgctcacaaattc
aaaggtgttgttatatctgttcacacatatttgaattatcttgtccaacaaaacaaggag
attggaaatgttattaaaagaattcctcaaatccaccacattgaggatgctcgaaagttt
catagttctggtaagaaagccgactacgtcatcaatgcggctggcttgaatgcatctaaa
ataaagggtgttgaagataaaaagttcaatttccctgtgcggggccaagttttgcttgtc
aaaaacaatgctaaaatacagttgggtgttgaagggtttcctggtttgcccaatgaaatg
ttgtacatgatgcctagaaaagaaggaggcacgattataggtggttgctttttagaaggg
aatacttcagtttcagaagataaagaattgactgcgagaatcataaaaagagccatcaaa
tatgcaccagaattggttgacccaaattacaaaaacaaccccagtaaaatcgagattgtt
aaagtaaatgtggggttcagaccatttagagaagatgatgcaagagtagaagtggacaaa
aaatataaatggttaattcacaattatggtgctggtgctggaggatatcaaggaagcttt
ggtttgagtaagttagtcgttgacattatggaaaaagaattgagtaaattcaaatcaaaa
ttataa

DBGET integrated database retrieval system