KEGG   Candida albicans: CaO19.1064Help
Entry
CaO19.1064        CDS       T00189                                 

Gene name
ACS2
Definition
similar to S. cerevisiae ACS2 (YLR153C) acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.1064 (ACS2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.1064 (ACS2)
   00620 Pyruvate metabolism
    CaO19.1064 (ACS2)
   00640 Propanoate metabolism
    CaO19.1064 (ACS2)
  Energy metabolism
   00680 Methane metabolism
    CaO19.1064 (ACS2)
Enzymes [BR:cal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CaO19.1064 (ACS2)
Lipid biosynthesis proteins [BR:cal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CaO19.1064 (ACS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 671 aa AA seqDB search
MPTEQTHNVVHEANGVKLRETPKEFFERQPNKGHIHDVNQYKQMYEQSIKDPQGFFGPLA
KELLSWDHDFHTVKSGTLKNGDAAWFLGGELNASYNCVDRHAFANPDKPALICEADDEKD
SHILTYGDLLREVSKVAGVLQSWGIKKGDTVAVYLPMNAQAIIAMLAIARLGAAHSVIFA
GFSAGSIKDRVNDASCKALITCDEGKRGGRTTNIKKLCDEALVDCPTVEKVLVYKRTNNP
EIHLTEGRDYYWDVETAKFPGYLPPVSVNSEDPLFLLYTSGSTGTPKGVVHSTAGYLLGA
ALSTKYIFDIHPEDILFTAGDVGWITGHTYALYGPLLLGVPTIIFEGTPAYPDYGRFWQI
VEKHKATHFYVAPTALRLLRKAGEQEIAKYDLSSLRTLGSVGEPISPDIWEWYNEFVGKN
QCHISDTYWQTESGSHLIAPLAGVVPNKPGSASYPFFGIDAALIDPVTGVEIEGNDAEGV
LAIKDHWPSMARTVYKNHTKYMDTYMNPYPGYYFTGDGAARDHDGYYWIRGRVDDVVNVS
GHRLSTAEIEAALIEDKKVSEAAVVGIHDDITGQAVIAYVALKEGNSDEDSEGLRKELVL
QVRKTIGPFAAPKSVIIVQDLPKTRSGKIMRRILRKVSSNEADQLGDISTLSNPQSVEGI
ISAFGAQFGKK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgccaacagaacaaactcataatgtcgtccatgaagccaatggcgtcaaattaagagaa
acccctaaagaattttttgaaagacaaccaaataaaggtcacattcatgatgtcaatcaa
tacaaacaaatgtatgaacaatctattaaagatcctcaaggatttttcggtccattggcc
aaagaattgttatcttgggatcacgatttccacactgtcaaatcaggtactttgaaaaat
ggtgatgcagcttggtttttgggtggtgaattgaatgcttcttacaactgtgttgataga
catgcatttgctaacccagataaaccagctcttatttgtgaagctgatgacgaaaaagat
tcccatatattgacttacggtgatttgttaagagaagtttctaaagtagctggtgtttta
caatcttgggggatcaagaaaggtgacactgttgctgtttacttaccaatgaatgcccaa
gctatcattgctatgttggctattgctagattgggtgctgcccattcagttatttttgct
gggttctcggctggttccattaaagacagagtcaacgatgctagttgtaaagctcttatc
acttgtgatgaaggtaaaagaggtggtagaaccactaacattaaaaaattatgtgatgag
gctttggttgattgtcctactgttgaaaaagttttggtttataaaagaactaataatcca
gaaattcatttaactgaaggtagagattactattgggatgttgaaactgccaaattccca
ggatacttgccaccagtttcagtcaactctgaagatccattgttcttattgtatacttct
ggttctactggtactccaaagggggttgttcattctactgctggttacttattgggtgct
gctctttccactaaatacatttttgatattcatccagaagatatcttgtttactgctggt
gatgttggttggattactggtcacacctatgccttgtatggtccattgttattaggtgtc
ccaaccattattttcgaaggtaccccggcttatccagattacggaagattctggcaaatt
gttgaaaaacacaaggctactcatttctatgttgctccaactgctttaagattattacgt
aaagctggtgaacaagaaattgctaaatacgatttgagttctttgagaactttaggttct
gttggtgaaccaatttctccagacatttgggaatggtataatgaatttgttggtaaaaac
caatgtcacatttctgacacttattggcaaactgaatctggatctcatttaattgcccca
ttggctggtgttgttccaaacaagccaggttctgcttcttatccattctttggtattgat
gctgccttgattgatccagtcactggtgttgaaattgaaggaaatgatgctgaaggtgtt
ttggctatcaaggaccattggccatcaatggcaagaactgtctacaagaaccacaccaaa
tatatggatacctacatgaatccatacccaggttattactttaccggtgatggtgctgct
agagatcatgatggatactactggattagaggtagagttgatgatgttgtcaatgtcagt
ggtcatagattatccactgctgaaattgaagctgctttaattgaagacaaaaaagtcagt
gaagctgctgttgttggtattcatgacgacattactggtcaagctgtcattgcttacgtt
gccttgaaagaaggaaacagtgacgaggattctgaaggattaagaaaagaattggtttta
caagttagaaaaactattggtccatttgctgcaccaaaatctgttataattgtccaagat
ttgccaaagactagatctggtaaaattatgagaagaattttgagaaaagtcagttctaat
gaagctgatcaattgggtgatatttctactttatctaacccacaatcagttgaaggtata
atttctgcctttggtgcccaattcggtaagaaataa

DBGET integrated database retrieval system