KEGG   Candida albicans: CaO19.1067Help
Entry
CaO19.1067        CDS       T00189                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cal01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cal01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cal00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cal00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cal00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 261 aa AA seqDB search
MGVHKLIILRHGESQWNHENKFCGWIDIPLSQKGKQEAIYAGELIKKNHLDPDILYTSKL
MRSIETGLTILEVLHKPWIDHIKTWRLNERHYGQYQGRDKHEVFVELGKDKEKFQYIRRD
YHGLPPLIEYGQDKSIDEKYKDVLNKDILPRGESLSMVMDRLIPFFKYEILDNQMIQLNK
TVLIVTHGSIVRSLIKYLNHVSDDDISKINVPTGIPLVFELNDRGELIKPYYYLDQEKAE
KGIAKVKMEGLERKGQTDEKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcataaattaataattctaagacatggagaatcacaatggaatcatgagaat
aaattctgtggatggattgatattccattatcacaaaagggcaaacaagaagcaatttat
gctggagaattaatcaaaaagaaccatcttgatcctgatatcttatatacatcgaaatta
atgcgatcaatagaaactggattgacaattttggaagtattacacaaaccatggattgat
catatcaaaacttggagattgaatgaacgacattatggtcaatatcaaggaagagataaa
catgaagtgtttgttgaattgggtaaagataaagagaaattccaatatattagaagagat
tatcatggattgccacccttaatagaatatggtcaagataaatcaattgatgaaaaatac
aaggatgtattgaataaagatatattacctcgaggagaatcattactgatggtgatggac
agattgattccgtttttcaaatatgaaatattagataatcaaatgattcaattgaataaa
actgttttgatagtgactcatggttcaattgttagaagtttgatcaaatatcttaatcat
gtaagtgatgatgatatatccaagattaatgtccctacaggtataccattggtatttgaa
ttgaatgatagaggtgaattgatcaaaccttattattatttggatcaagaaaaggcagaa
aaggggatcgccaaagtgaaaatggaaggtcttgaaagaaaaggacaaacagatgaaaaa
ctataa

DBGET integrated database retrieval system