KEGG   Candida albicans: CaO19.10741Help
Entry
CaO19.10741       CDS       T00189                                 

Gene name
CDC27
Definition
similar to S. cerevisiae CDC27 (YBL084C) anaphase promoting complex TPR repeat subunit
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cal  Candida albicans
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CaO19.10741 (CDC27)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CaO19.10741 (CDC27)
   04113 Meiosis - yeast
    CaO19.10741 (CDC27)
Protein phosphatases and associated proteins [BR:cal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CaO19.10741 (CDC27)
Ubiquitin system [BR:cal04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CaO19.10741 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 876 aa AA seqDB search
MHSTTGGRIGSRSGSTSTSNSNSAAGGTGATGATTTTTTTSSSTARILGPTLFQDETNSN
PNPKYIQQYLRSIIIHSLDTLNYQNAEFASERLLALMEQQREQQSHHHNHSQPQSQRDDE
NDEFLDSIYLYCLVLYRQDKYKTCYYKLSNLKKFDHHLSCSFLYGKCCLKLNKFKEGIFH
LIKTKKYHDINTSTTNNNNTSKFSGANTSNNDRFNKFNYEYNRNINPDISSIYHILGDLY
REINDLKNSCMNYTLCLKLNQFDFEAFQKLCKLGVNIRVKSIFKFQHQPYSKNNINNAFT
NVNVNTNTNSNNEGPTIPDLTNPFTDRSFNSKLTPSIHVDDFNFSTPRVKTTNNNTSISS
DAALRKSNLNNGSTTNAISNNSGGSTNNPSSINAAVSVAAAAAAAAASTTTTNNNNNNLD
FEFTKPSYPDDKRKSQSTYLRITSRLISQPQSSHNQHHNHNHHQQQQQQQQQTGSSQMET
PKKRNLKRNNSATLDPIYHQGTSASNSTTNAIPGISAATSSPATSSSTASASSLSSSSSI
IITKEIEKSEKHLLQLYLNLGKSYRSMCKYDCYKAIRMLETSLNEFEKNTPWVLSKLGRL
HYEIVNYPQSELYFTKLRKLDRTRLQDMEYYSTLLWHLNKKVELTYLANELHDLQPNAAI
TWCVIGNLFSLIHEPNESIKCFNRAIKLDKKFTYAYTLKGHEYFSNDNYEMALENFRISL
LLDPRHYNALYGLGMIYINLGDYEKADYHFRKAISINPINIILICCCGMVLEKLNKRTLA
IKQYELAHKLQPLNPLPIFKLGQLYFSLKNYSLALKNFEILKNLAPNEASVHFLLGQLYN
LQNDKFLAIKEFTVALNLDPKGNYLIREAMESLKKS
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgcattctactacaggaggaagaataggatcaagatcaggatcaacctcaacctcaaac
tcaaactcagcagctggaggaacaggagcgacgggagctacaacaacaacaacaaccacg
tcatcatcaacagcaagaatattaggtcctactcttttccaagatgaaaccaattctaat
cctaatcctaaatatattcaacaatatttaaggtcgattattattcattcattagatact
ttaaattatcaaaatgctgaatttgccagtgagagattattggctttaatggaacaacaa
cgtgaacaacaactgcatcatcataatcattcacaaccacaatcacaaagagatgatgaa
aatgatgaatttttagattcaatctatttatattgtcttgtattataccgacaagataaa
tataaaacttgttattataaattaagtaatttgaaaaaatttgatcatcatttaagttgt
tcatttctttatggtaaatgttgtttaaaattgaataaatttaaagaagggatatttcat
ttgattaaaactaaaaaatatcacgacataaatactagtactactaacaacaacaacacg
tctaaattttctggtgcaaacacaagtaataatgatcgattcaataaattcaattatgaa
tataatcgaaacattaatcctgatatatcactgatttatcatatattgggtgatttatat
cgtgagatcaatgatttgaaaaatagttgtatgaattatactttatgtttgaaattaaat
caatttgattttgaagcatttcaaaaattgtgtaaattgggagttaatattagagtcaaa
tcaattttcaaatttcaacaccaaccatatagtaaaaataatatcaataatgccttcaca
aatgttaatgttaacactaatactaattcaaataatgaaggaccaacaatacctgattta
acaaatccatttactgatagatcattcaactcaaaattaactccatcaattcacgttgat
gactttaatttttcaacaccaagagtgaaaactacaaataataataccagtataagttcc
gatgccgctttacgtaaatctaatttgaacaatggatcaacaacaaatgcaatctcaaac
aatagtggaggtagtaccaataatccgagttctatcaatgctgcagtttcagtggcagca
gcggcggcagcagcagcagcttcaactaccacgacaaacaataataacaacaatttagat
ttcgaatttaccaaacctagttaccccgatgataaaagaaaaagtcaaagcacttattta
agaataacatcaagattgatatcacagccacaatctctgcacaaccagcaccacaaccac
aaccaccatcaacaacaacaacaacaacaacaacaaacaggatcatcgcagatggaaaca
cctaaaaaaagaaatttaaagcgtaataactcggctacgttagatccaatatatcatcag
ggcacttctgcatctaattccactacaaatgcaattccaggtataagtgcagcaacatca
tcacctgcaacatcatcatctactgcttccgcatcatctctatcttcttcatcatcaatt
ataattactaaagagattgaaaaaagtgaaaaacatcttttgcaattatatttaaattta
ggtaagagttatcgaagtatgtgtaaatatgattgttacaaggcaataagaatgttagaa
acgtcattgaatgaatttgaaaaaaatactccttgggttttaagtaaattgggaagatta
cattatgaaattgttaattatcctcaatcagaattgtatttcaccaaattgagaaaattg
gatcgaactcgtttacaagatatggaatattatctgacattattatggcatttgaataaa
aaagttgaattgacttatttagccaatgaattacatgatttacaacccaatgctgccatc
acttggtgtgtgataggtaatttgttttcattgattcatgaaccaaatgaatcaatcaaa
tgtttcaatagagcaatcaaattagataaaaaattcacttatgcttatacattaaaaggt
catgaatatttcagtaatgataattatgaaatggcattagaaaatttccgtattagttta
ttactagatcctcgtcattataatgccttgtatggattaggaatgatttatattaatctt
ggtgattatgaaaaagccgattatcatttccgtaaagcaatttccattaatccaatcaat
ataattctaatttgttgttgtggtatggtattggaaaaattgaataaacgaactttagct
attaaacaatatgaattagctcataaattacaaccattaaatccattaccaatttttaaa
ttgggtcaattatattttagtttgaaaaattatctgttagctttgaaaaattttgaaatt
ttgaaaaatttagcacctaatgaagcaagtgttcatttcttattaggacaattgtataat
ttacaaaatgataaatttttggcaattaaagaatttaccgtggctttaaatttagatcct
aaaggtaattatttaattcgtgaagctatggaatcattgaaaaagagttga

DBGET integrated database retrieval system