KEGG   Candida albicans: CaO19.10877Help
Entry
CaO19.10877       CDS       T00189                                 

Gene name
UBP10
Definition
ubiquitin C-terminal hydrolase
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CaO19.10877 (UBP10)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.10877 (UBP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 256 aa AA seqDB search
MSLISRLQEDSTPKGKKLNESIIYDIFGGLLNQRITCHKCHNVSITKQEFYDLSLGLNKK
KIKSNNNGDNITNDSNKDDTTSTTATSTSTSTSDPIFNSNKFSVEKSINDFFSNEVIKKS
ENDSKSGYFCEKCNRFTHANKISSIEIAPETLTIHFKRFKFNNNSSSKVKQSINYSKYLD
LSKYMVQGTAKYRLTSVIVHEGRSISSGHYVAHCLQPDGYTWCTYDDEYINKIEERVALN
DPSAYVLVYTKLTPKV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaatctctagactacaagaagattctacaccaaaggggaaaaaattgaatgaa
tcgattatttatgatatctttggtggattattgaatcagcgtatcacgtgtcataaatgt
cataatgtttcaatcaccaagcaagaattttatgatttatcattagggttaaataaaaag
aaaatcaaatcaaacaataacggcgacaacattactaatgatagcaataaagatgatacc
acatccactactgccacttccacttccacctccacctccgacccaatcttcaatagtaat
aaattttctgttgaaaaatctattaatgattttttcagtaatgaagtaatcaaaaaactg
gaaaatgatagtaaatcaggttatttctgtgagaaatgtaatcgattcactcatgccaat
aaaatatcttccattgaaattgctcctgaaactttaaccattcatttcaaacgttttaaa
ttcaacaacaattcttcatccaaagtcaaacagctgataaattatagtaaataccttgat
ttaagcaaatatatggtacaaggcacagctaaatatcgtttgacatcagttattgttcat
gaaggaagatcaatttctagtggacattatgttgctcattgtttacaacctgatggatat
acttggtgtacttatgatgatgaatacattaataaaattgaggaaagagtggcattaaat
gatccttctgcttatgtgttggtatatactaaattaaccccaaaagtttag

DBGET integrated database retrieval system