KEGG   Candida albicans: CaO19.10878Help
Entry
CaO19.10878       CDS       T00189                                 

Definition
ubiquitin-specific protease
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 471 aa AA seqDB search
MYQSSSSKPKLNINNNSTTITTNPTTTLNPLLFATPLNFKPASTSTTLSTGFDNHIPKSY
IVLSNNSNNSSMKTSKKLGKSNTKKTTNDPPKPKSLNEAIANYTGNKYLTHKERKRKRKL
QEIITEDNQVPKEDQQEQGEDDEEEEETDEAKHVTKKVKKGMWDSIKSFWSSTPTSTPTP
PTEEEEEDLGENIEEKQEEEEEEEENEDHDSSSPGEVFTETSPFTGFSEPEKSEIDEEDE
EDDADFVDEESGSPESGDEDDEDVESDSMSPQASDDDDEDEDLEKLKYDLKIDQLVNDKD
VNEDEDEEEEEEEEETQERTSTTPPTSPEEDTEKQQPEPSEVSYYDINEYEDDRGSNNST
RIYKNWRELANKKPPVGLLNHGVTCYMNSAIQSIIHIPAMQHYLNDVNDNKYSQLKPRSV
THVLAELSKRMWLASNTNNNKKGKSNGGIKYINPKKIIQRLDEINCMMSEW
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatcttcatcttctaaaccaaagctaaacattaataataattccacaacaatc
accactaatccaactactaccctcaatcctttactttttgcaaccccattaaatttcaag
ccagcatctacatccaccacattaagcactgggtttgataatcatatacctaaatcatac
attgttttatcaaataacagcaacaactcaagtatgaaaacttccaagaaacttggtaaa
tcaaatactaaaaaaactactaatgatccaccaaaacctaaatctttaaatgaagcaatt
gctaattatactggcaataaatatttgactcataaggaaaggaaaaggaaaagaaaatta
caagaaataataactgaagataatcaagtccccaaagaagatcaacaagaacaaggtgaa
gatgatgaagaagaagaagaaaccgatgaggcaaaacatgtaactaaaaaagtgaaaaaa
ggaatgtgggattctattaaatcattctggctgagtacacctacttccacaccaacacca
cctacagaagaagaagaagaagatttaggagaaaatatagaagagaagcaagaggaagaa
gaggaagaggaagaaaacgaagaccatgattcaagttctcctggtgaagtatttactgag
acatcaccatttactggatttagtgaaccagaaaaaagtgaaattgacgaagaagatgaa
gaagatgatgcagattttgtggatgaagagtcaggttcacctgaaagtggtgatgaagat
gatgaagatgttgaatcagattctatgtcaccacaagcatctgatgatgacgatgaagat
gaagatttagaaaagttaaaatatgatttaaaaatcgatcaattagtcaacgacaaagat
gtcaatgaagacgaagacgaagaagaggaggaggaagaggaggaaacgcaagaacggaca
tcaactactccaccaacttcaccagaagaagacacagaaaagcagcaaccagagccactg
gaagtttcatattatgatattaatgaatatgaagatgatcgtggatctaataattctact
agaatatacaaaaattggagagaacttgctaacaagaaacctccagttggattattaaac
catggcgtcacctgttacatgaattcggcaattcaatcaattattcatataccggcaatg
caacattatttaaatgatgtgaatgataataaatattctcaacttaaaccaagatcagtg
acccatgttttagctgaattatctaaaagaatgtggttagcatcaaatactaacaacaat
aaaaagggtaaaagtaatggtggaatcaagtatattaatccgaaaaaaattattcaaaga
ttggatgaaattaattgcatgatgagtgaatggtaa

DBGET integrated database retrieval system