KEGG   Candida albicans: CaO19.10905Help
Entry
CaO19.10905       CDS       T00189                                 

Gene name
FDG1
Definition
similar to plant/bacterial Formamidopyrimidine-DNA glycosylase; same as cosmid orf Ca20C1.09
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cal  Candida albicans
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CaO19.10905 (FDG1)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CaO19.10905 (FDG1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CaO19.10905 (FDG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 322 aa AA seqDB search
MRKVLTNAVVTSVGRHGKYFWIRLNNHNTTNVLLMHFGMTGMIKLRNVHSHLAFMENGGD
KKALEKLERFRYKDSRIKPDVEVKQEWPPRFTKFNMELENNDKKLEFAFSDPRRLARVRL
LSGLEVSTDESLLKLSPLNALGPDYSKPEVPPKESEPFVFGDPDSDNHGRARLSIDEFSA
LILSKKKPIKSLLLDQTYFAGVGNWVADEVLFQAHIHPNEIISSKIPKDLEYVHPVIKQL
YDSLIYVCEEAVRVEGDVAKFPDDWLMLHRWGKGRKEKRKTPNGYILDHITVGGRTSCYC
PELQRLIKVETATTTKRRKVKR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtcttaacaaatgcagttgttacttcagtgggtcgtcatggcaagtatttt
tggattagactaaacaaccacaatacaactaacgtcttgcttatgcatttcggaatgact
ggaatgatcaagttacgaaatgttcattcgcatttagcatttatggaaaatggcggtgat
aaaaaggctttggagaagctagagaggtttagatataaagacagtagaattaaaccagac
gtcgaagtcaagcaagagtggcccccaaggtttacaaagtttaatatggaattggaaaac
aatgacaaaaaactagagtttgcattttccgatccaagaagattagccagggttcgacta
ctctctggtttggaagtaagcactgacgagagtttgttgaaattgagtcctttgaatgcc
ctaggtcccgattacagtaagcctgaagtaccgccaaaagaactggaaccctttgtattt
ggagatcctgattcagataaccatggtcgtgccagattgtctattgatgagtttagtgct
cttatcttgtcgaaaaagaaaccaataaagagtctccttttggatcagacttactttgct
ggggttggaaattgggtggctgatgaagttttatttcaagctcacattcatccaaatgaa
ataatttcaagtaaaatccctaaagatttggagtatgtgcatcctgttataaagcagttg
tatgattcattaatctatgtgtgtgaggaagctgttcgagttgaaggtgatgtggcaaag
tttccggacgactggttaatgttgcatcgatggggaaaaggtagaaaagaaaaaagaaaa
acaccaaatgggtatattttagaccacattacagttggggggagaacaagttgttattgt
ccagagttacagaggctaataaaagtagagacagcaacaacaactaaacgaagaaaagtc
aaaagatag

DBGET integrated database retrieval system