KEGG   Candida albicans: CaO19.1095Help
Entry
CaO19.1095        CDS       T00189                                 

Gene name
GLE2
Definition
WD40 repeat protein similar to S. cerevisiae GLE2 (YER107C) nuclear pore protein required for poly(A)+ RNA export
Orthology
K14298  
mRNA export factor
Organism
cal  Candida albicans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CaO19.1095 (GLE2)
Messenger RNA biogenesis [BR:cal03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CaO19.1095 (GLE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 383 aa AA seqDB search
MSFLGSSSTGTSTTATSSAVTGQELLNDITINNPPEDSIEDISFSPQQDLLAVASWDKKV
RIYEIDPNSGNNMGRAMYEHEAPVFSSRWSIDGTKIISGGADNQVKIFDLATQQAQQIGQ
HDSAVKSVRYVECGPTNTQVIASGSWDKTLKYWDMRSPQPVSTINLPERVYSMDNSQKLL
VVGCADRHISIIDLNNPQQIFKSSQSPLKWQTRCVSCYPQANGFAVGSIEGRCAIQYITE
NEQKKFGFSFKCHRKSGGNTTGTTNTTGGAGAGLRTTSSSNANESHAYSVNAISFHPIYG
TFSTAGSDGTFCFWDKDAKQRLKSFPELPGAISATAFNKTGTIFAYAISYDWSLGYMGNR
QDYPNIIKLHATKDLEIKQKNKR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcttgggtagttcgtcaacaggaacatcgaccacagccacatcaagtgctgtt
actggtcaagaattattaaatgatataaccataaataacccaccggaagattcaattgaa
gatatttcattctcaccacaacaagatttgttagctgtagcaagttgggataaaaaagtt
cgaatttatgaaattgatcctaattcaggaaataatatgggtcgagcaatgtatgaacat
gaagctccagttttcagttctcgatggtctattgatgggacgaaaattatatcaggtggt
gccgacaatcaagtgaaaatatttgatttggcaacccagcaagcccaacaaattggacaa
catgattctgccgttaaatcagttagatacgttgaatgtggtccaacaaatactcaagtt
attgctagtggatcatgggataaaacattaaaatattgggatatgagatcacctcaacct
gtttcaacaatcaatttaccagaaagagtttattcgatggataattctcagaaattatta
gttgttggatgtgctgatagacatattagtataattgatttgaataaccctcaacaaatt
ttcaaaagttcacaatcacccttgaaatggcaaactcgttgtgtttcatgttatcctcaa
gcaaatggatttgctgttggatctattgaaggaagatgtgccatacaatacattacagaa
aatgaacagaaaaaatttggattttcatttaaatgtcatagaaaatccggtggtaatact
actggtaccactaatactactggtggtgcaggtgcaggcttaagaaccacaagtagttct
aatgccaatgaatctcatgcatattcagtcaatgccatctcattccatcctatatatggt
acattcagtactgctggatcagatggtacattttgcttttgggataaagatgctaagcaa
cgattaaaatcgtttcctgaattgccaggggcaatatctgccactgcatttaataaaact
ggtactatatttgcctatgcgattagttatgattggtcattgggatatatgggtaataga
caagattatccaaatatcatcaaactacatgcaaccaaagatttagaaataaaacaaaag
aataaaaggtga

DBGET integrated database retrieval system