KEGG   Candida albicans: CaO19.11001Help
Entry
CaO19.11001       CDS       T00189                                 

Gene name
MCR1
Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cal  Candida albicans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cal00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 301 aa AA seqDB search
MLTHHLSKLATPKFLVPFAGATALSIGLALQYSTSNNYIANETGKTFTDSNEWVDLKLSK
SIDLTHNTKHLVFKLKDENDVSGLITASCLLTKFVTPKGNNVIRPYTPVSDVNQSGEIDF
VIKKYDGGKMSSHIFDLKEGETLSFKGPIVKWKWEPNQFKSIALIGGGTGITPLYQLLHQ
ITSNPKDNTKVNLIYGNLTPEDILLKKEIDAIASKHKDQVKVHYFVDKADEKKWEGQIGF
ITKEFLQKELEKPGSDFKVFVCGPPGLYKAISGPKVSPTDQGELTGALKDLGFEKEHVFK
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttgactcatcatttatcgaaattggctactccaaaattcttagtaccattcgctggt
gccactgctttgtcaattggtttggcattgcaatattctacttccaacaattacattgct
aacgaaactggtaaaactttcactgatagcaatgaatgggtggacttgaaattatctaag
tcaattgatttgactcataacaccaaacacttggttttcaagttaaaagatgagaatgat
gtttctggtttgatcactgcttcatgtttgttgaccaaatttgttacaccaaagggtaac
aatgttattcgtccatatacccctgtctctgatgttaaccaatctggtgaaattgatttc
gtgattaaaaaatacgacggaggtaaaatgtcaagtcacattttcgatttgaaagaaggt
gaaaccttatcattcaaaggaccaattgttaaatggaaatgggaaccaaatcaattcaag
tccattgctttgattggtggtggtactggtattactccattataccaattgttgcatcaa
atcacttctaatccaaaggacaacaccaaagttaatttgatttacggtaacttgactcca
gaagatatcttgttaaagaaagaaatcgatgctattgcttctaaacacaaggaccaagtt
aaagttcattactttgttgacaaggcagatgaaaagaaatgggaaggtcaaattggtttc
attactaaagaattcttacaaaaagaattagaaaaaccaggttctgatttcaaggttttt
gtttgtggtccaccaggtttatacaaggctatatcaggtcctaaagtttccccaactgat
caaggtgaattgactggtgctttgaaagatttgggtttcgaaaaagaacatgtctttaaa
ttttag

DBGET integrated database retrieval system