KEGG   Candida albicans: CaO19.11145Help
Entry
CaO19.11145       CDS       T00189                                 

Gene name
UBP16
Definition
putative ubiquitin-specific protease
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 823 aa AA seqDB search
MSEIWNQLKCLITNQDLNTIKHFPQPTTTTTQQIDCLSILNYPFIPTSLLNYWNRKTYSE
KKSLLLQISLILSISLYILTPSLPFYKQKPMFSKRPDKHTTGFINLRNDCFANSSLQAYS
SVPSLTDYLNKFIASYRQLVEFVKSNNIDIQELINLRLELNKNLQNSKFKRSNSTFEVPL
HMAMASMVKKLQETEMTTRTISVWTFLHELENIFNAKMSRSQHDAHELTQLINEPLKKET
WKFKGLGRLITWTWEPIWKGIPAPRDYAQLDKIVVPEFPFDGLILSQMTCLTCHGVSQPN
FTPFVILTLPVPMTTTTNLETLLEQNESEQIEGYQCIKCRVSKIAMNEEHLKRQIPLEDV
DYINKIIDLNNNPNLCINEDLPEDLENFIKNYNVEGIDASRITSTVQKKSQILKPPKIFG
LHLSRSSFDGQVVTRNSCRVKFSDKMTLSIGKEYHDKLKQFQTMVQKEDEKLREKYTSNV
LTTDENDMEDEDVQREDIDEKGEEDDDDDDEDVTTDDGTATENGTDDLDDETDEEEDDED
DISSVMSRETETQSVTTSSTIRPNSGPTGSSQEYSINSAPISHKQTDNLKELFKRFKFND
NDLYKYRLRAVIKHMGSHTQGHYECYKHKPLYVKDKNGNIFKLSPEIKDELTGEIHCEAT
PVESNPAQSNANNGSATMRSSSSGSSENDEGFRHKFSTMMGRRPSVFQANPTGVEEILSS
GLQTPAEILVDDPNQNNFENAFATHNFRDAFNGNKDTASNKKQEEEKKVKMKKIPSIISK
PYWRISDATVTEVSKASVLAEETTVYMLYYERVDRKQIKRHHG
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagatttggaatcaattaaagtgcctaattactaatcaagatctcaatactatt
aaacatttcccacaacctaccactactaccactcaacaaatcgattgcttatcaatttta
aattatccatttattccaacttcattactaaattattggaatcggaaaacttatctggaa
aagaaatctttacttttacaaatttcattgatactatcaatttctttatatattcttacc
ccttcattaccattttacaaacaaaaacccatgttttccaaacgtccagacaaacatacc
actggttttatcaatttacgaaatgactgtttcgccaattcctcgttgcaggcatattca
tctgtgccttcattgacggattatttgaacaagtttattgctagttaccgtcaattggtt
gaatttgttaaactgaacaatatcgacattcaagaattaatcaacttacgtttggaatta
aataaaaatttgcagaattcaaaattcaaacggtcaaattctacatttgaagtacctttg
catatggccatggcatcgatggtgaaaaaactacaagaaacagaaatgacaaccagaact
ataagtgtttggacttttcttcacgaattagaaaacattttcaacgccaaaatgtctaga
tctcaacatgatgctcatgaattaactcaattaattaatgaacctttaaaaaaggaaacc
tggaaatttaaaggtttggggagattaattacttggacctgggaacctatttggaaagga
atcccggccccacgagattatgctcaattagataaaattgttgtacctgaattcccattt
gacgggttgattttgagtcaaatgacttgtttgacctgtcatggagtttcccaaccaaat
ttcacaccatttgttatacttacattgccagtgcctatgaccaccaccactaatttggaa
acattattggaacaaaacgaaagtgaacaaattgaaggttatcaatgtattaaatgtcga
gttagtaaaattgccatgaatgaagagcatttgaaacgtcaaattccattggaagacgtt
gattatattaacaagattattgacttaaataacaacccgaatttgtgcattaatgaagat
ttacctgaagatttagagaactttatcaagaattataatgttgaagggattgatgcttca
agaatcacttcgacagttcagaaaaaatcacaaattttgaaacctccaaaaatatttgga
ttgcatctttcacgttcttctttcgatggccaagtagtaactagaaattcatgtcgagtc
aagttttcagataaaatgacattatcaataggtaaagagtatcatgataaattaaagcaa
tttcaaactatggtgcaaaaagaagacgaaaagttgagagaaaaatatacgtctaatgtc
ttgaccacagatgagaatgatatggaagacgaagatgtacaaagagaggatattgatgag
aagggggaagaagatgacgatgacgacgacgaagatgttacaaccgatgatggcactgct
acagaaaacggtaccgatgatttagatgatgagacagatgaagaggaagatgatgaagat
gatatttcatctgtcatgtcgagagaaactgaaactcaatcagtcactacttctagtacc
atcagaccaaattctggaccaactggtctgtctcaagaatactcaataaatctggctcca
atttctcataagcaaactgataatttgaaagaacttttcaaacgattcaaatttaatgat
aatgatttgtacaagtatcgtttgagagctgttattaaacatatgggatcacatactcag
ggtcattatgaatgttacaagcataaaccactttatgtgaaagacaaaaatggtaacatt
ttcaaattatcaccagagattaaagatgaattaactggtgaaattcattgtgaagccact
cctgttgaactgaaccctgcccagtccaatgctaataatggttcagctacaatgcgttcg
tctagtagtggttcaagtgaaaatgatgaagggttccgtcacaagttttcaaccatgatg
ggtcgtagaccttctgtattccaagctaatccgactggcgtggaagaaatcttactgtct
ggtttacaaactccagctgaaattttggtggatgatcctaatcaaaacaatttcgagaat
gcttttgctactcataattttagagatgcattcaacggcaataaagatactgcctccaat
aaaaaacaagaagaggaaaagaaagtgaaaatgaaaaaaattccttcaatcatttctaaa
ccttattggagaatcagtgatgctactgtcactgaagttagtaaggcatctgtattagct
gaggaaactacagtttatatgttgtattatgaaagagttgacaggaaacaaattaaacgt
catcatggttag

DBGET integrated database retrieval system