KEGG   Candida albicans: CaO19.1115Help
Entry
CaO19.1115        CDS       T00189                                 

Gene name
GUK1
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cal  Candida albicans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cal00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 243 aa AA seqDB search
MEKKKFFRVLLFTKINKEKKYASIYIYLLYMFNNFRRNISHIYRQSFLSNYRTMSSSANR
PIVISGPSGTGKSTLLKKLFAEYPDKFGFSVSNTTRKPRPGEVNGKDYNFSTVEEFKQLI
DENKFIEWAQFSGNYYGTTIKAVKDVAEQGRICLLDIDMQGVKSVKKTDLNARYLFISPP
SIEELKSRLTGRGTETEDSLQKRIAAASDEMEYAQTGAHDKIIVNDDLDKAYAEFKKFIV
DEQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaaaattttttcgtgtcttacttttcactaaaatcaacaaagaaaagaag
tatgcatctatatatatatacttactatatatgttcaacaattttaggagaaatatttcc
catatttatagacaatcatttttatcaaattatagaaccatgtcatcatctgccaataga
ccaatcgttatttccggtccatcaggtactggtaaatcaaccttattgaaaaaattattt
gctgaatatccagataaatttggattttcagtttcaaacaccaccagaaaaccaagacca
ggtgaagttaatgggaaagattataattttagtactgttgaagaattcaaacaattaatt
gatgaaaacaaattcattgaatgggcccaattttcaggtaattattatggcacaacaatt
aaagctgtcaaagatgttgctgaacaaggtagaatttgtttattggatattgatatgcaa
ggggttaaatcagttaagaaaaccgatttgaatgctagatatctttttataagtcctcct
tctattgaagaattgaaaagtcgattgactggtagaggtacggaaactgaagatagttta
caaaaaagaattgctgctgcttctgatgaaatggaatatgcccaaactggtgctcatgat
aaaataatcgttaatgacgatttggacaaagcttatgctgaattcaagaaatttatcgtt
gatgaacaataa

DBGET integrated database retrieval system