KEGG   Candida albicans: CaO19.11449Help
Entry
CaO19.11449       CDS       T00189                                 

Gene name
PFK1
Definition
phosphofructokinase alpha subunit that can functionally substitute for S. cerevisiae PFK1 (YGR240C)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.11449 (PFK1)
   01230 Biosynthesis of amino acids
    CaO19.11449 (PFK1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.11449 (PFK1)
   00030 Pentose phosphate pathway
    CaO19.11449 (PFK1)
   00051 Fructose and mannose metabolism
    CaO19.11449 (PFK1)
   00052 Galactose metabolism
    CaO19.11449 (PFK1)
  Energy metabolism
   00680 Methane metabolism
    CaO19.11449 (PFK1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CaO19.11449 (PFK1)
Protein phosphatases and associated proteins [BR:cal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CaO19.11449 (PFK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 987 aa AA seqDB search
MPSSSDAINRISYISLVTSDNDKFNQTFQFYSQLGFRLTKSFSKVSSYGSGLGANHPEFQ
LGVSHDSLKEVWLESYPLQNVDSNGNLRPWQEMEVYDGDNCERLNESTVIKVRLLGETPL
KSISQKQFVFFTTQLNKIEKILTDANVKYGKVVDNVILAEDPLSNIISFSNTQNELCKTR
FQSPEEYVEKTTAEILAKRKKSQLGSKFGSFEEISPSEVGGGNGLRKKKIGVMTSGGDAP
GMNPAVRAVVRAGIYYGCDVYAVYEGYEGLVKGGDLLKKMEWSDVRSYMSLGGTSIGTAR
CKEFRERAGRLQGAYNMIKNGIDALVVCGGDGSLTGADLFRSEWPSLVKELVDTGKLTKE
EVSPYEHLTIVGLVGSIDNDMSGTDVTIGAFSALERITEMVDYIGATAASHSRAFVVEVM
GRHCGWLALLSGLATGADFVFIPERPPKAGLWKEQLKEVCLRHREYGRRKTTVIVAEGAI
DDELNPITSEEVKQVLADLGLDTRNTILGHVQRGGTAVAFDRRLATLQGVEAVKAVLEMT
PDTPSPMIGILKHKIVRIPLVDAVKQTKAVAEAISNKDFDKAMSLRDNSFYDDYRYFRDI
SIYDDGSKQLSEDKRLNIAIVHVGAASAGLNAATRAVALYSLSRGHKLYAVQDGFAGLVK
GDLKNLTWMDVEGWHSLGGSEIGTNRSLPSQNIGKVAYNLQKFNIQGLLIVGGFEAFTSL
HELSEQKANYPIFEIPMVVVPATVSNNVPGTEYSLGADTCLNQLVSYCDAVQQSASSTRR
RVFVVEVQGGHSGYVASYCGLITGALATYTPESNINLRELQGDIDLLQKVFATDRGEDHN
GTLIVRNEQASAVYSTQLIADILKENANKRFETRTAIPGHVQQGFTPSANDRVMAVKFSL
KAMEFIETRNGCYGKHDRKFSDEEISEHSQVVIGIHGDVVKFTCIKHLYDNEANVALRKG
KTVHWTDMIDVANILNGKSLLKKQERY
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcctagctcctccgacgcaatcaataggataagttacatatcccttgtcaccagtgac
aatgacaaattcaaccaaacattccaattctacagtcaattgggatttagattgacaaaa
agtttctccaaagtttcaagctacggatctggattaggtgccaaccatccagaattccaa
ttgggtgtttctcatgattcacttaaagaagtttggttagaatcttacccattacaaaat
gtcgacagtaatggaaaccttcgtccttggcaagaaatggaagtttatgacggtgataat
tgtgaaagattaaatgaatcaactgtgattaaagttagattacttggcgaaacccctttg
aagtcaatttctcaaaaacaatttgtgtttttcaccactcaattgaataaaattgaaaaa
atcttgaccgatgcaaatgtcaaatatgggaaagttgttgataatgtcattttagctgag
gatccattaagcaacattatcagtttttccaatactcaaaatgaattgtgtaaaactaga
ttccaatcaccagaagagtatgttgaaaaaaccactgcagaaatattggctaaaagaaag
aaatctcaattgggttctaaatttggttcatttgaagaaatttcaccaagtgaagttggc
ggtggtaatggtttacgtaaaaagaaaattggggtgatgacatctggtggtgatgctcct
ggtatgaatccagcagttcgtgctgttgttagagccggtatttattatggttgtgatgtt
tatgccgtttacgaaggttatgaagggttagttaaaggaggtgatcttttaaagaagatg
gagtggagtgatgttcgttcttatatgtctcttggtggtacttcaattggtactgctaga
tgtaaagaatttagagaaagagccggaagattacaaggggcatacaatatgatcaagaat
ggtattgacgcattagttgtatgtggtggtgacggttcattaactggtgctgatttattt
agaagcgaatggccatcacttgtgaaggaattagtagacactggaaaattaactaaagaa
gaagtttcaccttatgaacatcttaccattgttggattggttggttccattgataatgat
atgtctggtaccgatgttaccattggtgcattctctgccttagaaagaatcacagaaatg
gttgattatattggtgccactgctgcttctcattctcgtgcttttgttgttgaagtcatg
ggtagacattgtggttggctagcattattgtctggtttggccactggagctgattttgtt
ttcattcctgaaagaccacctaaagccggattatggaaagaacaattgaaagaagtatgt
ttgagacacagagaatatggtagaagaaaaaccaccgttattgttgccgaaggggccatt
gatgatgaattgaacccaatcacttcagaagaagtcaaacaagttttagctgatttagga
ttggacaccagaaataccattttgggacatgttcaaagaggtggtactgctgttgctttt
gacagaagattggctactttacaaggggttgaagctgttaaagcagttttggaaatgaca
ccagacacaccatcaccaatgattggtatattgaaacacaagattgttagaattccatta
gttgatgctgttaaacaaactaaagctgtagctgaagccattagcaacaaagattttgat
aaagctatgagtttaagagacaatagtttctacgatgattatagatatttccgtgatatt
tctatttatgatgatggtagtaaacaattgagtgaagataagagattaaatattgcaatc
gttcacgttggtgccgcatctgctggtttaaatgctgccactcgtgcagtggcattgtac
agtctttctcgtggccacaaattgtatgctgtacaagatggatttgctggtttagtcaaa
ggtgatttgaagaacttgacatggatggatgttgaaggatggcatagtcttggtggttca
gaaatcggtaccaatagatccttaccatcacaaaacattggtaaagttgcctacaattta
caaaaattcaatatccaagggttattgattgttggtggatttgaagcttttacttcattg
catgaattatctgaacaaaaagccaattatccaatatttgaaattccaatggtggttgtt
ccagcaacagtttcaaacaatgttcctggtactgagtattctcttggtgctgacacctgt
ttgaatcaattagtttcatactgtgatgcagttcaacaatcagcatcttcaactagaaga
agagtgtttgtagttgaagtgcaaggtggtcacagtgggtatgttgcctcctactgtgga
ttgataactggtgctttagccacttatacacctgaatcaaacataaacttgagagaatta
caaggagatatcgatttattgcagaaagtgtttgccactgaccgtggtgaagatcataat
ggtactcttattgttagaaatgaacaagccagtgctgtttattcgactcaattgattgct
gatattcttaaagaaaatgccaataaaagatttgaaaccagaacagcaattccaggtcat
gttcaacaaggtttcacaccaagtgccaatgatcgtgttatggcagttaaattctcatta
aaagccatggaatttattgaaacaagaaatgggtgttatggtaaacacgatcgtaaattc
tctgatgaagaaatcagtgaacattctcaagttgtcattggtatccatggagatgttgtt
aaattcacatgtatcaaacatttgtatgataatgaagctaatgttgccttgagaaagggt
aagacagttcattggaccgatatgattgatgtggctaacattttgaacggtaaactgttg
ttgaaaaaacaagaaagatattag

DBGET integrated database retrieval system