KEGG   Candida albicans: CaO19.11590Help
Entry
CaO19.11590       CDS       T00189                                 

Gene name
PMT4
Definition
similar to dolichyl-P-mannose:protein mannosyltransferase involved in mannosylation of serine and threonine residues
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cal  Candida albicans
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CaO19.11590 (PMT4)
Enzymes [BR:cal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CaO19.11590 (PMT4)
Glycosyltransferases [BR:cal01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CaO19.11590 (PMT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 755 aa AA seqDB search
MSQTLKKRGGNSSGRKSPTTSNIEFDDKKTEFDLNAIVPPKEPEYKYLAALTLVTLLAIY
TRFTKLGTPNKVVFDEVHFGKFASYYLERTYFFDLHPPFAKLLIAFVGWLIGYDGKFKFE
AIGDSYIENNVPYIAYRSLSAIQGAAIVPIMFLTMKTLGFSVAACLFSSIIVCFDNAQVT
DSRLILLDATLILSVALTIFSYSKFSTFRKQPFSSKWWTWLLATGVSLSCVISTKYVGVF
TYLTIGIAVIHELWILLDYRKGLTLQEFAKHFFARLWALIIVPFCIYLYWFYLHFAILTR
SGPGDAFMSSEFQETLLESPLAAHSKPVQYFDQITIKHKDTGAFLHSHQHEYPLRYEDGR
ISSNGQQVTCVVQENAANDPNNQWEIVPTSEGANKGTKVYTNDIVRFRHVGTGGYLLTHD
VASPLKPTNEEFTVVYDDVAQQRYNETLFRLRLHVPGSNPKKEKNKKEIKTLATDLRILH
VDTVVAMWTHNDELLPEWAFNQQEVSGNKKIPDKDNIWNFDLITNLQSTDPRNQYVPKKV
KTLPFLRKWWELQMLMFHHNNQLSSEHPFATQPGEWPLALSGVSFYNDNTEKKQIFFIGN
IIGFWLEVCFLSIYIGILLADQITRRRNVHVLSDRARSRLYNTLGFLFVGWAAHYLPFFL
MNRQKFLHHYLPAHLVAALFSGGLVEFICSNNSARPNGKPVGVNKYKIIAVVAACSTAII
WFFFYFRPLTYGDVYLTPEEVKARQWLDIKLHYGK
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagactttaaaaaagagaggcggtaatagcagcggcaggaaatcgccaacaact
tctaacattgaatttgatgataagaaaactgagttcgatttgaatgcaattgttcctcca
aaagaaccagagtataaatacttggcagctctaactttggtaacccttctagcaatttac
actagattcacaaaactaggcactccaaataaagttgtttttgatgaagtccattttggt
aagtttgcgtcctactatttagaacgtacttatttctttgatttgcacccaccttttgcc
aaattgttaattgcatttgttgggtggcttattggctacgatggtaaatttaaatttgaa
gccattggtgactcttacattgaaaataatgttccatatattgcatacagatctttactg
gctattcaaggtgccgcaattgtcccaattatgtttttaaccatgaaaactttagggttc
tccgttgcagcttgtttgttttctagtataattgtgtgctttgataacgcccaagtcact
gattcaagattgattttgttagatgctacattaattctcagtgttgcattgactatattt
tcgtattccaagttttcaacatttagaaaacagccattttcttcgaaatggtggacctgg
ttgttagccacaggggtatctttatcatgtgttatctccacgaaatacgttggtgttttc
acatatcttaccattggtattgctgttattcacgaattatggatcttgttagattatagg
aaagggttgactttgcaagaatttgcaaaacacttttttgccagattatgggctcttata
attgttccattctgcatttatttgtattggttctacttacattttgccattttgactaga
tctggcccaggtgatgcattcatgtctagtgaatttcaagaaactttgttggagtcgcca
ttagctgctcactccaaaccagtgcaatattttgatcaaattactatcaagcacaaagat
actggtgcatttttgcactcacaccaacacgagtatccattgcgttacgaggatggaaga
atttcttccaatggacaacaagttacttgtgtagtacaggaaaatgctgccaatgatcca
aacaaccaatgggaaatagttccaactctggaaggagccaacaaaggcaccaaagtttac
acaaatgacattgtcagatttagacacgttggtaccggtggttatttattaactcacgat
gtggcttcacctttgaaaccaaccaatgaagagtttactgttgtttatgacgacgttgcc
caacaacgttacaatgagacattatttagattgagattgcatgttccaggttcaaaccca
aagaaagaaaagaataaaaaagaaatcaaaacgttagcaactgacttgagaattttacat
gttgatactgtggtagctatgtggacccataatgatgaattattaccagaatgggctttc
aaccaacaagaagtcagtggtaataaaaaaataccagataaggacaatatttggaatttc
gatttgatcaccaatttgcaaagcaccgatccaagaaaccagtatgttcctaaaaaagtc
aagactttaccatttttaagaaagtggtgggaattacaaatgttaatgttccatcataac
aatcaattatcatcagaacatccatttgcaacacaacctggtgaatggcctttggcatta
tctggggtttccttctacaacgacaacaccgagaaaaaacagattttctttattggaaac
atcattgggttctggttagaagtttgtttcttgtcgatttatatcggtattttattggct
gatcaaataacacgtcgtcgtaacgtacacgtgttaagcgacagagcaagatcaagattg
tacaacactttgggatttttgtttgttggctgggctgcccattacttgccattcttcttg
atgaaccgtcaaaagtttttgcatcattacttaccagcacacttggtggctgcattgttt
tctggtggacttgttgaattcatttgctccaacaactcagctagaccaaatggcaagcct
gttggggtcaacaagtacaagattattgctgttgttgctgcttgttctactgctattatc
tggttcttcttctatttcagaccgcttacttatggtgatgtttacttgactcctgaggaa
gttaaagctagacaatggttagacatcaagttgcattatggtaaataa

DBGET integrated database retrieval system