KEGG   Candida albicans: CaO19.11889Help
Entry
CaO19.11889       CDS       T00189                                 

Gene name
HOS1
Definition
histone deacytylase family protein similar to S. cerevisiae HOS1 (YPR068C) which acts on ribosomal RNA gene histones
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CaO19.11889 (HOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 436 aa AA seqDB search
MNSVCLLYTIYPQKENVCSVCKQKKNAPQKKPCPPPCKYCQTSPMATKRKVYITLSEFAT
KIVDLLPSNKGRQSLVLGLIEAYKLIDLCDGTIDIYPAQTKDLTTYHDDEFVKHLMGPRT
FLDKNFNKIDKAETDLTNIVIEENDLDEKYGLTFDCYPFPSLDLYVQLTAASSINAARKI
VQQVKETKDQIIAVNWYGGRHHCHKSHAAGFCYVNDVVLSINILRKNLGSVFYLDLDLHH
GDGVENAFKFSKKVATCSIHRYDIGFYPGTGSLKSSRENTYNIPTEKGLNDSSMLWIIKE
IVAPLISNFGPRAIVIQCGCDGLALDTHKEWNMTIKGYRDSIDWILSHFSEIPIMLLGGG
GYSHTETAKCWTYLTGSVLGVSDIDTWDILPEHKNLDAYEKDGFRFWTDHNSGPSKMKDH
NSVEYLNDIKTHLLSL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaactctgtttgtctcttatatactatttacccccaaaaagaaaatgtttgtagcgta
tgtaaacaaaagaaaaacgccccccagaaaaaaccatgtccaccaccatgcaagtattgt
caaacactgccaatggcaacaaagagaaaagtgtatattacactatcagagtttgcaacc
aagatagtagatttactcccgtccaataagggaagacagtcgttagtactaggtttaatc
gaggcatataaattgatagacttgtgtgatggaactatagatatttatcccgctcaaact
aaagatcttacaacatatcacgacgacgagtttgttaaacatttgatgggacctcgaaca
tttctagataaaaatttcaacaaaattgataaggcagaaacagatttaacaaatattgta
atagaggaaaatgatctagatgagaaatatggactaactttcgattgttatccattccca
tctttggacttatatgtgcagttaactgcagcttctagtataaatgctgctagaaaaata
gttcaacaggtcaaggaaaccaaagatcaaataattgcagtgaattggtatggaggaaga
caccattgccacaaatctcatgcagctgggttctgctatgtgaatgatgtggtactatca
attaatattctacgtaaaaatttgggttctgtgttttatcttgatttagatttgcatcat
ggggatggggttgaaaacgcattcaagttttccaaaaaagttgctacttgttcgatacat
agatatgatattggattctatcctggtactgggagtttaaaaagctctagggagaataca
tacaatattccaactgagaaggggctaaatgattctagtatgttatggataatcaaagaa
attgtagctcccttgatactgaattttggcccaagggctattgtcattcaatgtggttgt
gatggattggctctagatacacataaggaatggaatatgactattaaggggtatcgtgac
agtatagactggatactaagtcattttagtgaaattccaataatgttattaggtggtgga
ggatacagccatacagagacagcaaaatgttggacatatcttacaggtctggttctaggg
gtcagtgatatcgatacatgggatatactaccagaacacaaaaatttagatgcatatgaa
aaagatggtttcagattttggacggatcacaattcaggtcctagtaaaatgaaagatcac
aatagtgtagaatatttaaatgacattaaaacccatttattgtctctataa

DBGET integrated database retrieval system