KEGG   Candida albicans: CaO19.11980Help
Entry
CaO19.11980       CDS       T00189                                 

Gene name
SAD2
Definition
one of a tandem pair of alcohol dehydrogenase genes similar to C.parapsilosis sadh NAD(+)-dependent, S enantiomer-selective secondary ADH (BAA24528); similar to S. cerevisiae ADH1 (YOL086C)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CaO19.11980 (SAD2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.11980 (SAD2)
  Lipid metabolism
   00071 Fatty acid degradation
    CaO19.11980 (SAD2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CaO19.11980 (SAD2)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CaO19.11980 (SAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 349 aa AA seqDB search
MQTQSGYGYVEGYSDIQKFTDIPIPTPKGNEVLLKVEAAGLCLSDPHVLIAGPIESKPPI
PLATKFVMGHEIAGSVSAVGEQLVNDPNYKKGARFALQIAKACGMCDSCRKGYDGVCDSS
HQAYGLNEDGGFQQYLLVKNLRTLLPIPEGVSFEQAAVTTDSVLTPFHAIQKVRHLLTPT
SKVLVQGCGGLGLNAVQILKNYGCYIVASDVKGAVEKLALEYGANEFHTDIGKSKHEPMS
FDVIFDFVGIQPTFNNSDKFIKRRGKIVMVGLGRSKLLIPNYKLGIREVEIIFNFGGHSA
EQVECMEWVAKGLIKPNVHVADFNSLPQYLEDLANGKLTGRVVFRPNKL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcaatcaggatatggatacgtcgaaggatattcagacattcaaaaattcact
gatatcccaattccaacgccaaaagggaatgaagtattattaaaagtggaagctgccgga
ttatgtctttctgatccccatgtattaattgctggtccaattgaaagtaaacctccaatt
ccattagctacaaaatttgtcatgggtcatgaaattgccggatctgttagtgctgttggt
gaacaattagttaacgatccaaattataaaaaaggtgctagatttgctttacaaattgct
aaagcttgtggaatgtgtgattcatgtcgtaaaggatatgatggtgtttgtgatctgagt
catcaagcctacgggttgaatgaagatggtggttttcaacaatatttgttagtcaaaaat
ttacgtactttattacctatccctgaaggtgtcagttttgaacaagccgcagtcactacc
gattcagtattgactccattccatgctatacaaaaagtcagacatttgttaacaccaaca
tcaaaagtattagtacaaggatgtggaggattgggattgaatgccgttcaaatattgaaa
aattacggttgttatattgttgcatctgatgtcaaaggtgccgttgagaaattggcattg
gaatatggtgctaatgaattccataccgatattggaaaatccaagcatgaaccaatgtca
tttgatgtgatttttgactttgtcggtattcaaccaacattcaataattctgataaattt
attaaaagacgaggtaaaatagtaatggtagggttaggaagatcaaaattattaattcca
aattataaattggggattcgtgaagttgaaatcattttcaattttggtggtcattctgcc
gaacaagttgaatgtatggaatgggttgcaaagggtttaattaaacctaatgttcatgtt
gctgatttcaattctttgccacaatatcttgaagatttggctaatggtaaattaacagga
agagttgtatttagacctaataaattgtaa

DBGET integrated database retrieval system