KEGG   Candida albicans: CaO19.11980Help
Entry
CaO19.11980       CDS       T00189                                 

Gene name
SAD2
Definition
one of a tandem pair of alcohol dehydrogenase genes similar to C.parapsilosis sadh NAD(+)-dependent, S enantiomer-selective secondary ADH (BAA24528); similar to S. cerevisiae ADH1 (YOL086C)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cal01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cal00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cal00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cal00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 349 aa AA seqDB search
MQTQSGYGYVEGYSDIQKFTDIPIPTPKGNEVLLKVEAAGLCLSDPHVLIAGPIESKPPI
PLATKFVMGHEIAGSVSAVGEQLVNDPNYKKGARFALQIAKACGMCDSCRKGYDGVCDSS
HQAYGLNEDGGFQQYLLVKNLRTLLPIPEGVSFEQAAVTTDSVLTPFHAIQKVRHLLTPT
SKVLVQGCGGLGLNAVQILKNYGCYIVASDVKGAVEKLALEYGANEFHTDIGKSKHEPMS
FDVIFDFVGIQPTFNNSDKFIKRRGKIVMVGLGRSKLLIPNYKLGIREVEIIFNFGGHSA
EQVECMEWVAKGLIKPNVHVADFNSLPQYLEDLANGKLTGRVVFRPNKL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcaatcaggatatggatacgtcgaaggatattcagacattcaaaaattcact
gatatcccaattccaacgccaaaagggaatgaagtattattaaaagtggaagctgccgga
ttatgtctttctgatccccatgtattaattgctggtccaattgaaagtaaacctccaatt
ccattagctacaaaatttgtcatgggtcatgaaattgccggatctgttagtgctgttggt
gaacaattagttaacgatccaaattataaaaaaggtgctagatttgctttacaaattgct
aaagcttgtggaatgtgtgattcatgtcgtaaaggatatgatggtgtttgtgatctgagt
catcaagcctacgggttgaatgaagatggtggttttcaacaatatttgttagtcaaaaat
ttacgtactttattacctatccctgaaggtgtcagttttgaacaagccgcagtcactacc
gattcagtattgactccattccatgctatacaaaaagtcagacatttgttaacaccaaca
tcaaaagtattagtacaaggatgtggaggattgggattgaatgccgttcaaatattgaaa
aattacggttgttatattgttgcatctgatgtcaaaggtgccgttgagaaattggcattg
gaatatggtgctaatgaattccataccgatattggaaaatccaagcatgaaccaatgtca
tttgatgtgatttttgactttgtcggtattcaaccaacattcaataattctgataaattt
attaaaagacgaggtaaaatagtaatggtagggttaggaagatcaaaattattaattcca
aattataaattggggattcgtgaagttgaaatcattttcaattttggtggtcattctgcc
gaacaagttgaatgtatggaatgggttgcaaagggtttaattaaacctaatgttcatgtt
gctgatttcaattctttgccacaatatcttgaagatttggctaatggtaaattaacagga
agagttgtatttagacctaataaattgtaa

DBGET integrated database retrieval system