KEGG   Candida albicans: CaO19.12129Help
Entry
CaO19.12129       CDS       T00189                                 

Gene name
SAP114
Definition
similar to S. pombe SWAP domain-containing SAP114 (SPAC22A12.09c ) pre-mRNA splicing factor; weak similarity to S. cerevisiae PRP21 (YJL203W) U2 snRNP factor
Orthology
K12825  
splicing factor 3A subunit 1
Organism
cal  Candida albicans
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:cal03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 425 aa AA seqDB search
MTSIPSDIKLPPSDVKQTIDKTVGYVIKNGKSFEERLLKNNKNDKFTFIKPDNEYFPYYK
WKLDTSKKNQGSTETSTENQHQEEDIIIAKPPDLPFLIDLPIISQHDLDVIKITALYIAQ
NGESKIPKLLQHETKLNNRAQFEFLNESHSLHDLFQKYIQQYKIVIELYQNSHGENVDQD
QEYLQLRQLIKKPRGEYDILTQAYNRAQYIKQNKVIAKREQEESKARQLHYASIDWQDFS
IVAKVDFNAIDAVKELSMPLKRDDLIKRSLDARSKDIELPKVAVAATTTSPVQVEVIDTK
NQGSTQDQTDNNTSTPSAPPIKGMKIKAAGTSRLKKSSEANTSMTTTNTIKCPITGKLIP
ENEFDTHIKTLLRDPRYKKEQENYIRKNFSYASNITTDQVYENIKRFVKKRANVEDENPK
KKKKA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacttctataccgtctgatataaaactaccgccatctgatgtcaaacaaacaattgat
aaaacagtaggctatgttattaaaaatggaaaatcttttgaagaacgattattgaaaaat
aataaaaatgataaattcacttttattaaaccagataatgaatattttccttattataaa
tggaaattagatacgtcaaagaaaaatcaagggctgactgaaacgtcaactgaaaatcaa
caccaagaagaggatataataatagcaaaaccaccagatttaccctttttaatagattta
cccattatttcacaacacgatttagatgttattaagataacagcgttatacattgctcaa
aatggtgaatcaaaaatcccaaaattattacaacatgaaactaaattgaataatcgagct
caatttgagtttttaaatgaatctcattctttacatgatttatttcaaaaatatattcaa
caatataaaatcgtgattgaattgtatcaaaactctcatggcgaaaacgtagaccaagac
caagaatatcttcaattgcgacaattaataaagaaaccacgaggagaatatgatatctta
acccaagcatataatcgggcccaatatataaagcaaaataaagtgattgccaagagagaa
caagaagagtccaaagctcgacaattacattatgcactgattgattggcaagatttttca
atagttgctaaagttgattttaatgctattgatgcggttaaagaattgagtatgccgtta
aaacgagatgatttgataaaacgatcattggatgccagaagtaaagatattgaattacca
aaagtagcagtggcggcgacaacaacatcaccagtacaagttgaagtaattgataccaag
aaccaaggtctgacccaagatcagactgataataatacatctactccatctgcaccacca
atcaagggaatgaaaattaaagctgctggaacttcacgattgaaaaaatcactggaagca
aacacttcaatgacgacgacaaatacgattaaatgccctattacaggtaaactaattcca
gaaaatgaatttgatacacatataaaaaccttgttacgtgatccaagatataaaaaagaa
caagaaaattatatacggaagaatttcagttatgcgtccaatattacaactgatcaagta
tatgaaaatattaaacgatttgtgaagaaaagagctaatgttgaagatgaaaacccaaaa
aagaaaaagaaagcttag

DBGET integrated database retrieval system