KEGG   Candida albicans: CaO19.1253Help
Entry
CaO19.1253        CDS       T00189                                 

Definition
similar to conserved hypothetical protein; potential Helix-loop-helix DNA-binding domain
Orthology
K06658  
phosphate system positive regulatory protein PHO4
Organism
cal  Candida albicans
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CaO19.1253
Transcription factors [BR:cal03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Fungal regulators
    CaO19.1253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 659 aa AA seqDB search
MDQQVWNPIFSPSGTTPGKSPSYYNELAPQSQSHISNQDPQLPLQTQHHQLFHIDGGSNH
STPSGNIQLPSSSQQNTPHIVSNTPTAFADSDQVFLQHMEMYDNQQHTNQSAGNTPGPIS
FHNHNPNLQQASQQPHQHISPHLNNLQQHSQQPYQHQHSHSRSHIDSEAPSANDTPTSSG
ALGMAPQPPLLSSTTNPQSFDLGLDTIGFIIPEELNFDTDPNHISSAFPPQLPADQTPSL
LAVDKLKQLQQQQQQQQRQQDPLSELSSPVLPGQNDQSYNPHHYYHRQSSSNSVFVAGKN
TGSSVSAPSQHVRPDAVFTPLVSPVVAPLDTNGKADKENGNNSGGHNNSHSSSFSPQPAV
QISFEPLTSPALNAEPSTIKSKGGKKNHKETDDRRRSTSSAYAPSKDENKQYKRRTPHGT
PILQGHTSNATTVNGSGKPYKSPITKNGKNSQKQDFSFTNQFEKLPESTITVKSEPMETS
VEPPLAPQGQQQDDSNPMLPPNGKPVEITGAPLMGFTMGKLAEGGAGTVADKKSAKKAGA
NNGKLSRKPSYSKNRNSVSSSSDESSSTSASTSPKMLANNGTNSSGKRSEKPATKKASHK
LAEQGRRNRMNNAVQELGRLIPQSYHDEVSIPSKATTVELASKYITALLKEVEELKGRK
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcaagtttggaaccctatattttcaccaagcgggacaacaccaggaaagtct
ccttcttactacaatgagttggctcctcaatcacagagtcacatatctaatcaagatccg
caactcccattacagactcaacaccaccaactatttcatatagatggtggctccaatcat
tcaaccccgtcaggtaatattcaactaccatcgtcgtctcaacaaaacacgccacatatt
gtttctaatactcccactgcttttgcagacagtgatcaggtgttcttacaacatatggaa
atgtatgacaaccaacaacacactaaccagtctgcaggcaatactccgggaccaatatca
ttccataatcataatcctaatttacaacaagcatcccaacagccacatcagcacatatcc
ccacatttgaacaacctacaacaacatagtcaacagccataccaacatcaacattctcat
tcacgctcacatatagactctgaagcaccatctgcaaatgacaccccaacttcttctggt
gccttgggcatggccccacaaccaccactcctttcatcaacaaccaaccctcaatctttt
gatctcgggttagacacaataggttttattattcctgaagagttgaattttgatactgat
ccaaatcacatatcctctgcatttccgccgcaattgcctgctgaccagactccaagttta
ttagcagttgataaattgaaacagttacaacaacaacaacagcaacaacagagacaacaa
gaccctttaagtgaactttcatcgccagtgctacctggacaaaacgatcaatcatataat
ccacatcattactatcatcgacagagttcaagcaatagtgtttttgtcgccggcaaaaat
actggttcatccgtttcagcaccctcacagcacgtaagacccgatgctgtctttaccccc
ttagtttcgcccgtcgttgcccctttagatacaaatggcaaggctgataaggaaaatggt
aataatagtggtggtcacaacaatctgcacagtagctcattctcccctcaacctgctgta
cagatttctttcgaaccattgacgtcgcctgcattgaatgccgagccatctacaataaaa
tctaaaggtgggaagaaaaatcacaaggaaactgacgatagaagaagatcaactagttca
gcatatgctcctagtaaagatgagaacaaacaatacaaacgtagaactcctcatggaacg
ccaattttgcaaggtcatacaagcaatgctaccacggtcaatggtagtggtaaaccatac
aagtcaccaattacaaaaaatggcaagaattctcaaaagcaggacttttcttttacaaat
cagtttgaaaagttaccggaatctacgataactgtgaaaagtgaaccaatggaaacatca
gtagaaccaccactagcaccacaaggacaacaacaagatgacagtaatccaatgttacct
ccaaatggtaaaccggttgaaataaccggagctccattaatggggttcactatgggtaaa
ctagctgaaggtggagccggaacagttgctgataaaaagctggccaaaaaagcaggtgct
aacaatggcaaactatcacgtaaaccaagctattcaaaaaacaggaattcagtatcttca
agctccgatgaatcatcttccacttctgcttcaacatcaccaaaaatgctagcaaataat
ggtaccaactccagtggtaaaagatctgaaaagccagcaacaaaaaaggcttcccataag
ttagcagaacaagggagaagaaatagaatgaataatgcagtacaagaattgggaagattg
attccccagagttatcacgatgaagtaagtattccttcaaaggcaacaacagttgaatta
gcctcgaaatatatcactgctttattgaaagaagttgaggagttgaaaggaaggaagtaa

DBGET integrated database retrieval system