KEGG   Candida albicans: CaO19.12542Help
Entry
CaO19.12542       CDS       T00189                                 

Gene name
PFY1
Definition
can functionally substitute for S. cerevisiae actin-binding protein profilin (PFY1/YOR122C) which
Orthology
K05759  
profilin
Organism
cal  Candida albicans
Brite
Exosome [BR:cal04147]
 Exosomal proteins
  Proteins found in most exosomes
   CaO19.12542 (PFY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 126 aa AA seqDB search
MSWQAYTDNLIANGKVDKAALYSRAGDALWAQSGSFELQQPEITEIAKGFDSAEGLQTSG
LHVQGQKYFLLRADDRSIYGKHEAEGVICVRTKQTILIAHYPSGVQPGEATTLVEKLADY
LINVGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcctacactgataacttaattgctaacggtaaagtcgataaagcagcc
ttatattcaagagccggtgacgcattatgggcccaatcgggatcattcgaattacaacaa
ccagaaatcactgaaattgccaaaggtttcgatagtgctgaaggtttgcaaaccagcggt
ttacacgttcaaggccaaaagtactttttgttaagagctgacgacagatcaatttatggt
aaacacgaagccgagggtgttatttgtgttagaactaaacaaactattttgatcgcccat
tatccaagtggtgttcaaccaggtgaagctaccactcttgttgaaaaattagccgattac
ttgatcaatgtcggttattag

DBGET integrated database retrieval system