KEGG   Candida albicans: CaO19.12583Help
Entry
CaO19.12583       CDS       T00189                                 

Gene name
OLE1
Definition
one of two potential fatty acid desaturase genes similar to S. cerevisiae OLE1 (YGL055W) delta-9-fatty acid desaturase; same as cosmid orf Ca41C10.02
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cal  Candida albicans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CaO19.12583 (OLE1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CaO19.12583 (OLE1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CaO19.12583 (OLE1)
Lipid biosynthesis proteins [BR:cal01004]
 Desaturase
  First
   CaO19.12583 (OLE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 486 aa AA seqDB search
MTTVEQLETVDITKLNAIAAGTNKKVPRVVAAGLGGKLMGTSDLVKVTAEEITKDSMESL
AEKDAREKAKYANKKHISEEPWTLDNFAKKINWLNMILVVFIPVFGAYCAWNYPPQWKTL
VLTFVMYAFSGISITAGYHRLYSHKSYDAALPVRLFFAFFGAGAIEGSIKWWGHSHRIHH
RYTDTPRDPYDARRGFWFSHMGWMLTKANPKNRARADISDLVADWVVTFQHRHYLLLMIT
AAFIFPTLVAGLGWGDYWGGFIYAGILKGFAIQQATFCVNSLAHWIGVQPFDDRRTPRDH
VLTAFVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKVTIWCLSKLGLAWNLKKFSQNAIE
QGLVQQQQKKLDRMKNKLNWGAEIEKLPVWTREEFNERAKQEGLIIISGIIHNVKNFIKE
HPGGQALVRASLGKDATKAFNGAVYAHSNAAHNLLATMRVAVVKDGEVNADTFDLQEQMM
EKEKQS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactacagttgaacaacttgaaactgttgatatcactaaattgaatgccattgctgct
ggtactaataagaaggtgccaagagtagtggctgctgggttaggtggtaaattaatgggt
acttccgatttagttaaggtcactgccgaagaaatcaccaaagattcaatggaatcatta
gctgaaaaggatgccagagaaaaggcaaaatatgccaacaagaaacacatttcagaagag
ccatggactttagacaattttgccaaaaaaatcaattggcttaacatgattttggttgtt
ttcatccctgtatttggagcttactgcgcctggaattacccaccccaatggaagactcta
gtgttgacatttgtcatgtatgcctttagtgggatttccattactgctggttaccatcgt
ttgtattctcacaaatcatatgatgctgctttgccagtgagacttttctttgcctttttc
ggtgccggtgccattgaaggttcaatcaaatggtggggtcattctcatcgtattcaccac
agatacaccgatactccaagagacccatatgatgccagaagaggtttctggttttctcac
atgggatggatgttgactaaagccaacccaaagaacagagctagagccgacatttctgat
cttgttgccgactgggttgtcaccttccaacacagacattatttgttgcttatgattaca
gctgcatttattttcccaactttggttgctggattgggctggggtgactactggggaggg
ttcatttatgctggtattttgaaaggttttgccattcaacaagctactttctgtgtcaac
tccttggcccattggattggtgttcaaccatttgacgatagaagaacccctcgtgatcat
gtgttaacagcatttgtgacatttggtgaaggttaccataacttccatcacgaattccca
agtgattacagaaatgcattgaaatggtaccaatacgacccaaccaaagttaccatttgg
tgtttatccaaacttggattggcctggaacttgaagaagttttcccaaaatgccattgaa
caaggtttagtccaacaacaacaaaagaaacttgatagaatgaagaacaaattgaactgg
ggtgcagaaatcgaaaaattaccagtctggactagagaagaattcaacgaaagagctaaa
caagaaggattgattatcatttctggtataattcacaacgttaagaacttcattaaagaa
caccctggtggtcaagctcttgttagggcttctttgggtaaagacgccacaaaggccttc
aacggtgctgtatatgctcattcaaatgctgctcacaacttgttggcaaccatgagagtt
gctgtagttaaagatggtgaagttaacgctgacacttttgatttacaagaacaaatgatg
gagaaggaaaagcaatcttag

DBGET integrated database retrieval system