KEGG   Candida albicans: CaO19.12583Help
Entry
CaO19.12583       CDS       T00189                                 

Gene name
OLE1
Definition
one of two potential fatty acid desaturase genes similar to S. cerevisiae OLE1 (YGL055W) delta-9-fatty acid desaturase; same as cosmid orf Ca41C10.02
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cal  Candida albicans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cal01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cal01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 486 aa AA seqDB search
MTTVEQLETVDITKLNAIAAGTNKKVPRVVAAGLGGKLMGTSDLVKVTAEEITKDSMESL
AEKDAREKAKYANKKHISEEPWTLDNFAKKINWLNMILVVFIPVFGAYCAWNYPPQWKTL
VLTFVMYAFSGISITAGYHRLYSHKSYDAALPVRLFFAFFGAGAIEGSIKWWGHSHRIHH
RYTDTPRDPYDARRGFWFSHMGWMLTKANPKNRARADISDLVADWVVTFQHRHYLLLMIT
AAFIFPTLVAGLGWGDYWGGFIYAGILKGFAIQQATFCVNSLAHWIGVQPFDDRRTPRDH
VLTAFVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKVTIWCLSKLGLAWNLKKFSQNAIE
QGLVQQQQKKLDRMKNKLNWGAEIEKLPVWTREEFNERAKQEGLIIISGIIHNVKNFIKE
HPGGQALVRASLGKDATKAFNGAVYAHSNAAHNLLATMRVAVVKDGEVNADTFDLQEQMM
EKEKQS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactacagttgaacaacttgaaactgttgatatcactaaattgaatgccattgctgct
ggtactaataagaaggtgccaagagtagtggctgctgggttaggtggtaaattaatgggt
acttccgatttagttaaggtcactgccgaagaaatcaccaaagattcaatggaatcatta
gctgaaaaggatgccagagaaaaggcaaaatatgccaacaagaaacacatttcagaagag
ccatggactttagacaattttgccaaaaaaatcaattggcttaacatgattttggttgtt
ttcatccctgtatttggagcttactgcgcctggaattacccaccccaatggaagactcta
gtgttgacatttgtcatgtatgcctttagtgggatttccattactgctggttaccatcgt
ttgtattctcacaaatcatatgatgctgctttgccagtgagacttttctttgcctttttc
ggtgccggtgccattgaaggttcaatcaaatggtggggtcattctcatcgtattcaccac
agatacaccgatactccaagagacccatatgatgccagaagaggtttctggttttctcac
atgggatggatgttgactaaagccaacccaaagaacagagctagagccgacatttctgat
cttgttgccgactgggttgtcaccttccaacacagacattatttgttgcttatgattaca
gctgcatttattttcccaactttggttgctggattgggctggggtgactactggggaggg
ttcatttatgctggtattttgaaaggttttgccattcaacaagctactttctgtgtcaac
tccttggcccattggattggtgttcaaccatttgacgatagaagaacccctcgtgatcat
gtgttaacagcatttgtgacatttggtgaaggttaccataacttccatcacgaattccca
agtgattacagaaatgcattgaaatggtaccaatacgacccaaccaaagttaccatttgg
tgtttatccaaacttggattggcctggaacttgaagaagttttcccaaaatgccattgaa
caaggtttagtccaacaacaacaaaagaaacttgatagaatgaagaacaaattgaactgg
ggtgcagaaatcgaaaaattaccagtctggactagagaagaattcaacgaaagagctaaa
caagaaggattgattatcatttctggtataattcacaacgttaagaacttcattaaagaa
caccctggtggtcaagctcttgttagggcttctttgggtaaagacgccacaaaggccttc
aacggtgctgtatatgctcattcaaatgctgctcacaacttgttggcaaccatgagagtt
gctgtagttaaagatggtgaagttaacgctgacacttttgatttacaagaacaaatgatg
gagaaggaaaagcaatcttag

DBGET integrated database retrieval system