KEGG   Candida albicans: CaO19.12595Help
Entry
CaO19.12595       CDS       T00189                                 

Gene name
PDI1
Definition
one of two genes similar to S. cerevisiae PDI1 (YCL043C) ER protein disulfide isomerase and foldase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CaO19.12595 (PDI1)
Enzymes [BR:cal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CaO19.12595 (PDI1)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CaO19.12595 (PDI1)
  Exosomal proteins of colorectal cancer cells
   CaO19.12595 (PDI1)
  Exosomal proteins of bladder cancer cells
   CaO19.12595 (PDI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 560 aa AA seqDB search
MKFWTYSTKVLATLLAVVSITHASGPTDGDAVADPNSAVVKLTSENFASFIEENPLILAE
FFAPWCGYCKMLGPEYSKAADSLNESHPKIKLAQIDCTEDEALCMEHGIRGYPTLKIIRD
GDSKTAEDYQGPREAAGIADYMIKQSLPAVQFPETFEELDTLIDAQTKPFVLQINPTEDG
NATFNKVANQKRKDYVFINVEDKQIIKDLNKKFKNVDITGKKPSYLVVQPKQFDEVAKFD
GKKIDAESLTEFIGVEAVPYFGEINQDTYMTYMTSPLPIAYYFYNNAEQREAIADDLTKL
GKKYRGKLNIVGLDASLFGRHAEVINMDPEVVPLFAIHHISDNKKFGVNQTDYPEGPSFK
VIEKFVADYFADKLTPIIKSEPLPTEEEKSANPVVKLVAHNYKDVLEQTDKDVFVKYYAP
WCGHCKKLAPTWEELAEIFGSNKDDAKVVVADIDHTNNDVDVPYNIEGYPTLLMFPANGK
VDEKTGIREPIVFEGPRELDTLIEFIKEKGALNVDGAELKAKLDEQKATKEDEEVEEEKE
EEEEEEAPVEDKENVEHDEL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttggacttactcaactaaagtgttagctactttattagctgttgtctctatt
actcacgccagtggtccaaccgatggtgacgccgttgccgatccaaacagtgctgtcgtt
aaattgacttcagaaaactttgcctccttcattgaagaaaatccattgattttggccgaa
ttctttgccccatggtgtggttactgtaaaatgttgggaccagaatattctaaagctgct
gattccttgaatgaatcccatccaaagattaaattggcccaaattgactgtactgaagat
gaagccttgtgtatggaacatggaatcagaggttacccaactttaaaaatcattagagat
ggtgatagcaaaactgctgaagactatcaaggtccaagagaagctgctggtattgccgat
tacatgattaaacagtctttaccagctgttcaattccctgaaacttttgaagaattggat
actttaatcgatgctcaaactaaaccatttgttttacaaatcaatcctactgaagatggt
aacgcaactttcaataaagttgctaatcaaaagagaaaagattacgtctttattaatgtt
gaagataaacaaattatcaaagatttaaataaaaaattcaagaatgttgacatcaccggt
aagaaaccaagctatttggtggtccaaccaaaacaatttgatgaagttgccaaatttgat
ggtaagaaaatcgatgctgaatccttgactgaattcattggtgttgaagcagttccatac
tttggtgaaatcaaccaagacacttatatgacttatatgacttctccattgccaattgct
tactatttctataataatgctgaacaaagagaagccattgctgacgatcttaccaagttg
ggtaagaaatacagaggtaagctcaatattgttggtttagatgctagcttgtttggtaga
cacgctgaggttatcaatatggacccagaagttgtcccattgtttgccattcatcatatt
tctgataacaagaaattcggagttaaccaaactgattaccctgaaggtccatcattcaaa
gtcattgaaaagtttgttgctgattactttgctgataaattgaccccaattattaaatca
gagccattaccaacagaagaagagaagtcagctaatccagtagttaaattagtggcccac
aattacaaagatgttttggaacaaaccgataaagatgttttcgtcaaatactatgctcct
tggtgtggtcattgtaagaaattggctccaacttgggaagaattggctgaaatctttggt
tctaataaagatgatgctaaagttgttgttgctgatattgaccatactaataatgatgtt
gatgttccatataacattgaaggttacccaactttattgatgttcccagctaatggtaaa
gtcgatgaaaaaaccggaattagagaaccaattgttttcgaaggtccaagagaattagat
actttgatcgaatttattaaagaaaaaggggcattgaatgttgatggtgctgaattgaaa
gctaaattggatgaacaaaaagctactaaagaagatgaagaagtggaagaagaaaaggaa
gaagaagaagaagaagaagctccagttgaagacaaagaaaatgttgaacacgatgaattg
tag

DBGET integrated database retrieval system