KEGG   Candida albicans: CaO19.12607Help
Entry
CaO19.12607       CDS       T00189                                 

Gene name
DFR1
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cal  Candida albicans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CaO19.12607 (DFR1)
   00670 One carbon pool by folate
    CaO19.12607 (DFR1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CaO19.12607 (DFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
7
AA seq 192 aa AA seqDB search
MSKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYENEIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQPKSELQKFVGDTVLEDDIKEG
DFTYNYTLWTRK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaccaaatgttgcaatcattgtcgcggcattaaagcctgctttgggaattgga
tacaaaggtaaaatgccttggagactccgtaaggaaataagatatttcaaagacgtcacc
accagaacaacgaaaccaaatactcgtaatgctgttattatgggaagaaagacatgggaa
tccataccacagaagtttagacctcttccagatagattaaacataatattatctagatca
tacgaaaatgaaattattgatgacaatatcattcatgccagctcaattgagtcgtcactt
aatcttgtatctgatgtcgaaagagttttcataattggaggggcagaaatttacaatgaa
ttgataaataattctttagtgagtcatctattaattacagaaatcgaacatccaagccca
gaatctattgaaatggatacctttttgaaattcccattggaaagttggaccaaacaacca
aaatcagagttgcagaaatttgttggagatactgtattagaagacgatatcaaggaaggt
gattttacctataattatacactatggacaagaaaataa

DBGET integrated database retrieval system