KEGG   Candida albicans: CaO19.12607Help
Entry
CaO19.12607       CDS       T00189                                 

Gene name
DFR1
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cal  Candida albicans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cal00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cal00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
7
AA seq 192 aa AA seqDB search
MSKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYENEIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQPKSELQKFVGDTVLEDDIKEG
DFTYNYTLWTRK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaccaaatgttgcaatcattgtcgcggcattaaagcctgctttgggaattgga
tacaaaggtaaaatgccttggagactccgtaaggaaataagatatttcaaagacgtcacc
accagaacaacgaaaccaaatactcgtaatgctgttattatgggaagaaagacatgggaa
tccataccacagaagtttagacctcttccagatagattaaacataatattatctagatca
tacgaaaatgaaattattgatgacaatatcattcatgccagctcaattgagtcgtcactt
aatcttgtatctgatgtcgaaagagttttcataattggaggggcagaaatttacaatgaa
ttgataaataattctttagtgagtcatctattaattacagaaatcgaacatccaagccca
gaatctattgaaatggatacctttttgaaattcccattggaaagttggaccaaacaacca
aaatcagagttgcagaaatttgttggagatactgtattagaagacgatatcaaggaaggt
gattttacctataattatacactatggacaagaaaataa

DBGET integrated database retrieval system